NKG2D/CD314/KLRK1 Active Protein | NKG2D active protein

Recombinant Human NKG2D/CD314/KLRK1 Protein

Cat. Num. AAA9139850

• Purity: >95% by SDS-PAGE.
• Synonyms: NKG2D/CD314/KLRK1; Recombinant Human NKG2D/CD314/KLRK1 Protein; NKG2D active protein

• Host: Human Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
• Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
• Sequence Length: 216

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its ability to bind its antibody in a functional ELISA. The ED50 for this effect is typically Less than 5 ug/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the N-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human NKG2D/CD314/KLRK1 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 30 kDa.)

Related Product Information for NKG2D active protein

Description: Recombinant Human NKG2D/CD314/KLRK1 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Phe78-Val216) of human NKG2D/CD314/KLRK1 (Accession #P26718) fused with a 6xHis tag at the N-terminus.

Background: This protein represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein.

Product Categories/Family for NKG2D active protein

CD Antigen

NCBI and Uniprot Product Information

• NCBI GI #: 315221164
• NCBI Accession #: NP_001186734.1
• NCBI GenBank Nucleotide #: NP_001186734.1
• UniProt Accession #: P26718
• NCBI Official Full Name: NKG2-D type II integral membrane protein
• UniProt Protein Name: NKG2-D type II integral membrane protein
• UniProt Gene Name: KLRK1
• UniProt Synonym Gene Names: D12S2489E; NKG2D
• UniProt Entry Name: NKG2D_HUMAN

Uniprot Description

KLRK1: Receptor for MICA, MICB, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Involved in the immune surveillance exerted by T- and B-lymphocytes. 1 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.2-p12.3

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; receptor activity; carbohydrate binding

Biological Process: regulation of immune response; T cell costimulation; natural killer cell activation; innate immune response; cell differentiation; positive regulation of natural killer cell mediated cytotoxicity; signal transduction