Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ZW10 blocking peptide

ZW10 Peptide - C-terminal region

Gene Names
ZW10; HZW10; KNTC1AP
Reactivity
Human
Synonyms
ZW10; ZW10 Peptide - C-terminal region; ZW10 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NKKYQEEVPVYVPKWMPFKELMMMLQASLQEIGDRWADGKGPLAAAFSSS
Sequence Length
779
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ZW10 blocking peptide
This is a synthetic peptide designed for use in combination with anti- ZW10 Antibody, made

Target Description: This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. This protein is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis.
Product Categories/Family for ZW10 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85 kDa
NCBI Official Full Name
centromere/kinetochore protein zw10 homolog
NCBI Official Synonym Full Names
zw10 kinetochore protein
NCBI Official Symbol
ZW10
NCBI Official Synonym Symbols
HZW10; KNTC1AP
NCBI Protein Information
centromere/kinetochore protein zw10 homolog
UniProt Protein Name
Centromere/kinetochore protein zw10 homolog
Protein Family
UniProt Gene Name
ZW10
UniProt Entry Name
ZW10_HUMAN

NCBI Description

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. This protein is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. [provided by RefSeq, Aug 2011]

Uniprot Description

ZW10: Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores. Involved in regulation of membrane traffic between the Golgi and the endoplasmic reticulum. Belongs to the ZW10 family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 11q23.2

Cellular Component: kinetochore microtubule; kinetochore; spindle pole; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; cytoplasm; cytosol; nucleus

Molecular Function: centromeric DNA binding; protein binding

Biological Process: meiosis; ER to Golgi vesicle-mediated transport; protein transport; mitotic sister chromatid segregation; establishment of mitotic spindle orientation; cell division; mitotic cell cycle checkpoint; regulation of exit from mitosis; protein complex assembly; mitotic cell cycle; mitotic metaphase plate congression; Golgi organization and biogenesis

Research Articles on ZW10

Similar Products

Product Notes

The ZW10 zw10 (Catalog #AAA3246475) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ZW10 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKKYQEEVPV YVPKWMPFKE LMMMLQASLQ EIGDRWADGK GPLAAAFSSS. It is sometimes possible for the material contained within the vial of "ZW10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.