Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

WDR18 blocking peptide

WDR18 Peptide - N-terminal region

Gene Names
WDR18; Ipi3; R32184_1
Reactivity
Human
Applications
Western Blot
Synonyms
WDR18; WDR18 Peptide - N-terminal region; WDR18 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAW
Sequence Length
432
Applicable Applications for WDR18 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for WDR18 blocking peptide
This is a synthetic peptide designed for use in combination with anti-WDR18 Antibody, made

Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Product Categories/Family for WDR18 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
WD repeat-containing protein 18
NCBI Official Synonym Full Names
WD repeat domain 18
NCBI Official Symbol
WDR18
NCBI Official Synonym Symbols
Ipi3; R32184_1
NCBI Protein Information
WD repeat-containing protein 18
UniProt Protein Name
WD repeat-containing protein 18
UniProt Gene Name
WDR18
UniProt Entry Name
WDR18_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

WDR18: a WD40 repeat protein. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding

Biological Process: multicellular organismal development

Research Articles on WDR18

Similar Products

Product Notes

The WDR18 wdr18 (Catalog #AAA3242211) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The WDR18 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR18 wdr18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PMWSCIVWEL HSGANLLTYR GGQAGPRGLA LLNGEYLLAA QLGKNYISAW. It is sometimes possible for the material contained within the vial of "WDR18, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.