WBP4 blocking peptide
WBP4 Peptide - N-terminal region
Gene Names
WBP4; FBP21
Reactivity
Human
Applications
Western Blot
Synonyms
WBP4; WBP4 Peptide - N-terminal region; WBP4 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG
Sequence Length
376
Applicable Applications for WBP4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for WBP4 blocking peptide
WBP4,WW domain binding protein 4 (formin binding protein 21),FBP21; MGC117310; WBP4,WW domain-binding protein 4,WW domain-binding protein 4,WBP-4,formin binding protein 21,formin-binding protein 21,domain-containing binding protein 4,WW domain-containing binding protein 4,WW domain-containing-binding protein 4
Target Description: This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A.
Target Description: This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A.
Product Categories/Family for WBP4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
WW domain-binding protein 4
NCBI Official Synonym Full Names
WW domain binding protein 4
NCBI Official Symbol
WBP4
NCBI Official Synonym Symbols
FBP21
NCBI Protein Information
WW domain-binding protein 4
UniProt Protein Name
WW domain-binding protein 4
Protein Family
UniProt Gene Name
WBP4
UniProt Synonym Gene Names
FBP21; FNBP21; WBP-4
UniProt Entry Name
WBP4_HUMAN
NCBI Description
This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A. [provided by RefSeq, Jul 2008]
Research Articles on WBP4
Similar Products
Product Notes
The WBP4 wbp4 (Catalog #AAA3235667) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The WBP4 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WBP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WBP4 wbp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NHKENVAKRI SEIKQKSLDK AKEEEKASKE FAAMEAAALK AYQEDLKRLG. It is sometimes possible for the material contained within the vial of "WBP4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
