VPS33B blocking peptide

VPS33B Peptide - middle region

Cat. Num. AAA3247198

• Reactivity: Human
• Synonyms: VPS33B; VPS33B Peptide - middle region; VPS33B blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIM
• Sequence Length: 526

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for VPS33B blocking peptide

This is a synthetic peptide designed for use in combination with anti- VPS33B Antibody, made

Target Description: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and encodes the human ortholog of rat Vps33b which is homologous to the yeast class C Vps33 protein. The mammalian class C vacuolar protein sorting proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Mutations in this gene are associated with arthrogryposis-renal dysfunction-cholestasis syndrome. Alternative splicing results in multiple transcript variants.

Product Categories/Family for VPS33B blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 574584823
• NCBI GeneID: 26276
• NCBI Accession #: NP_001276077.1
• NCBI GenBank Nucleotide #: NM_001289148.1
• UniProt Accession #: Q9H267
• Molecular Weight: 60 kDa
• NCBI Official Full Name: vacuolar protein sorting-associated protein 33B isoform 2
• NCBI Official Synonym Full Names: VPS33B late endosome and lysosome associated
• NCBI Official Symbol: VPS33B
• NCBI Protein Information: vacuolar protein sorting-associated protein 33B
• UniProt Protein Name: Vacuolar protein sorting-associated protein 33B
• Protein Family: Vacuolar protein sorting-associated protein
• UniProt Gene Name: VPS33B
• UniProt Synonym Gene Names: hVPS33B
• UniProt Entry Name: VP33B_HUMAN

NCBI Description

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and encodes the human ortholog of rat Vps33b which is homologous to the yeast class C Vps33 protein. The mammalian class C vacuolar protein sorting proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Mutations in this gene are associated with arthrogryposis-renal dysfunction-cholestasis syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]