Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

VPREB3 blocking peptide

VPREB3 Peptide - middle region

Gene Names
VPREB3; 8HS20; N27C7-2
Reactivity
Human
Applications
Western Blot
Synonyms
VPREB3; VPREB3 Peptide - middle region; VPREB3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNA
Sequence Length
123
Applicable Applications for VPREB3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for VPREB3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-VPREB3 Antibody, made

Target Description: The protein encoded by this gene is the human homolog of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-B cells.
Product Categories/Family for VPREB3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
pre-B lymphocyte protein 3
NCBI Official Synonym Full Names
V-set pre-B cell surrogate light chain 3
NCBI Official Symbol
VPREB3
NCBI Official Synonym Symbols
8HS20; N27C7-2
NCBI Protein Information
pre-B lymphocyte protein 3
UniProt Protein Name
Pre-B lymphocyte protein 3
Protein Family
UniProt Gene Name
VPREB3

NCBI Description

The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. [provided by RefSeq, Apr 2015]

Uniprot Description

VPREB3: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. Belongs to the immunoglobulin superfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q11.23|22q11

Cellular Component: endoplasmic reticulum; extracellular region; extracellular space

Biological Process: immune response; immunoglobulin production; leukocyte migration

Research Articles on VPREB3

Similar Products

Product Notes

The VPREB3 vpreb3 (Catalog #AAA3242031) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The VPREB3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPREB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VPREB3 vpreb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIRDYGVSWY QQRAGSAPRY LLYYRSEEDH HRPADIPDRF SAAKDEAHNA. It is sometimes possible for the material contained within the vial of "VPREB3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.