UVSSA blocking peptide
UVSSA Peptide - C-terminal region
Gene Names
UVSSA; UVSS3; KIAA1530
Reactivity
Human
Applications
Western Blot
Synonyms
UVSSA; UVSSA Peptide - C-terminal region; UVSSA blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV
Sequence Length
709
Applicable Applications for UVSSA blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for UVSSA blocking peptide
This is a synthetic peptide designed for use in combination with anti-UVSSA Antibody, made
Target Description: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.
Target Description: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.
Product Categories/Family for UVSSA blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Synonym Full Names
UV stimulated scaffold protein A
NCBI Official Symbol
UVSSA
NCBI Official Synonym Symbols
UVSS3; KIAA1530
NCBI Protein Information
UV-stimulated scaffold protein A
UniProt Protein Name
UV-stimulated scaffold protein A
Protein Family
UniProt Gene Name
UVSSA
UniProt Synonym Gene Names
KIAA1530
UniProt Entry Name
UVSSA_HUMAN
NCBI Description
The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex, and is thought to be involved in the transcription-coupled nucleotide excision repair (TC-NER) pathway to help remove lesions in the DNA that block transcription. Defects in this gene can cause UV-sensitive syndrome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Research Articles on UVSSA
Similar Products
Product Notes
The UVSSA uvssa (Catalog #AAA3238325) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The UVSSA Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UVSSA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UVSSA uvssa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQDLGSSRYS GKGRGKKRRY PSLTNLKAQA DTARARIGRK VFAKAAVRRV. It is sometimes possible for the material contained within the vial of "UVSSA, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
