UST blocking peptide
UST Peptide - N-terminal region
Gene Names
UST; 2OST
Reactivity
Human
Applications
Western Blot
Synonyms
UST; UST Peptide - N-terminal region; UST blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
Sequence Length
406
Applicable Applications for UST blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for UST blocking peptide
This is a synthetic peptide designed for use in combination with anti-UST Antibody, made
Target Description: UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.
Target Description: UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.
Product Categories/Family for UST blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
uronyl 2-sulfotransferase
NCBI Official Synonym Full Names
uronyl 2-sulfotransferase
NCBI Official Symbol
UST
NCBI Official Synonym Symbols
2OST
NCBI Protein Information
uronyl 2-sulfotransferase
UniProt Protein Name
Uronyl 2-sulfotransferase
Protein Family
UniProt Gene Name
UST
UniProt Synonym Gene Names
DS2ST
UniProt Entry Name
UST_HUMAN
NCBI Description
Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (Kobayashi et al., 1999 [PubMed 10187838]).[supplied by OMIM, Mar 2008]
Research Articles on UST
Similar Products
Product Notes
The UST ust (Catalog #AAA3233235) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The UST Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UST can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UST ust for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PPRFLLDLRQ YLGNSTYLDD HGPPPSKVLP FPSQVVYNRV GKCGSRTVVL. It is sometimes possible for the material contained within the vial of "UST, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
