Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

USP9X blocking peptide

USP9X Peptide - C-terminal region

Gene Names
USP9X; FAF; FAM; DFFRX; MRX99; MRXS99F
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
USP9X; USP9X Peptide - C-terminal region; USP9X blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
Sequence Length
2570
Applicable Applications for USP9X blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for USP9X blocking peptide
This is a synthetic peptide designed for use in combination with anti-USP9X Antibody, made

Target Description: This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for USP9X blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
292kDa
NCBI Official Full Name
probable ubiquitin carboxyl-terminal hydrolase FAF-X isoform 3
NCBI Official Synonym Full Names
ubiquitin specific peptidase 9 X-linked
NCBI Official Symbol
USP9X
NCBI Official Synonym Symbols
FAF; FAM; DFFRX; MRX99; MRXS99F
NCBI Protein Information
probable ubiquitin carboxyl-terminal hydrolase FAF-X
UniProt Protein Name
Probable ubiquitin carboxyl-terminal hydrolase FAF-X
UniProt Gene Name
USP9X
UniProt Synonym Gene Names
DFFRX; FAM; USP9; hFAM
UniProt Entry Name
USP9X_HUMAN

NCBI Description

This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

USP9X: Deubiquitinase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important role regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Regulates chromosome alignment and segregation in mitosis by regulating the localization of BIRC5/survivin to mitotic centromeres. Specifically hydrolyzes both 'Lys-29'- and 'Lys-33'-linked polyubiquitins chains. Specifically deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33. Interacts with SMAD4, MARK4, NUAK1 and BIRC5/survivin. Widely expressed in embryonic and adult tissues. Belongs to the peptidase C19 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.19.12; Protease; Ubiquitin-specific protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: Xp11.4

Cellular Component: growth cone; membrane; apical part of cell; cytoplasm; cytosol

Molecular Function: protein binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity; cysteine-type peptidase activity

Biological Process: mitosis; proteasomal ubiquitin-dependent protein catabolic process; transcription initiation from RNA polymerase II promoter; protein deubiquitination; transcription, DNA-dependent; axon extension; in utero embryonic development; hippocampus development; neuron migration; female gamete generation; negative regulation of transcription from RNA polymerase II promoter; cerebellar cortex structural organization; post-embryonic development; chromosome segregation; BMP signaling pathway; cell division; transforming growth factor beta receptor signaling pathway; gene expression

Disease: Mental Retardation, X-linked 99

Research Articles on USP9X

Similar Products

Product Notes

The USP9X usp9x (Catalog #AAA3239230) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The USP9X Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP9X can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the USP9X usp9x for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQYQQNNHVH GQPYTGPAAH HMNNPQRTGQ RAQENYEGSE EVSPPQTKDQ. It is sometimes possible for the material contained within the vial of "USP9X, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.