Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TSPAN4 blocking peptide

TSPAN4 Peptide - middle region

Gene Names
TSPAN4; NAG2; NAG-2; TM4SF7; TSPAN-4; TETRASPAN
Reactivity
Human
Applications
Western Blot
Synonyms
TSPAN4; TSPAN4 Peptide - middle region; TSPAN4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW
Sequence Length
238
Applicable Applications for TSPAN4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TSPAN4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TSPAN4 Antibody, made

Target Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for TSPAN4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
tetraspanin-4 isoform a
NCBI Official Synonym Full Names
tetraspanin 4
NCBI Official Symbol
TSPAN4
NCBI Official Synonym Symbols
NAG2; NAG-2; TM4SF7; TSPAN-4; TETRASPAN
NCBI Protein Information
tetraspanin-4
UniProt Protein Name
Tetraspanin-4
UniProt Gene Name
TSPAN4
UniProt Synonym Gene Names
NAG2; TM4SF7; Tspan-4; NAG-2
UniProt Entry Name
TSN4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

TSPAN4: is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced isoforms have been identified. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: focal adhesion; integral to membrane; plasma membrane; vesicle

Molecular Function: integrin binding; antigen binding

Biological Process: protein complex assembly

Research Articles on TSPAN4

Similar Products

Product Notes

The TSPAN4 tspan4 (Catalog #AAA3232486) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TSPAN4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSPAN4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSPAN4 tspan4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YTDKIDRYAQ QDLKKGLHLY GTQGNVGLTN AWSIIQTDFR CCGVSNYTDW. It is sometimes possible for the material contained within the vial of "TSPAN4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.