Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRPV5 blocking peptide

TRPV5 Peptide - N-terminal region

Gene Names
TRPV5; CAT2; ECAC1; OTRPC3
Reactivity
Human
Synonyms
TRPV5; TRPV5 Peptide - N-terminal region; TRPV5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRA
Sequence Length
729
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRPV5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TRPV5 Antibody, made

Target Description: TRPV5 constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating.
Product Categories/Family for TRPV5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 5
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily V member 5
NCBI Official Symbol
TRPV5
NCBI Official Synonym Symbols
CAT2; ECAC1; OTRPC3
NCBI Protein Information
transient receptor potential cation channel subfamily V member 5
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 5
UniProt Gene Name
TRPV5
UniProt Synonym Gene Names
ECAC11 PublicationManual assertion based on opinion iniRef.1; ECaC; ECaC1; OTRPC3

NCBI Description

This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. [provided by RefSeq, Jul 2008]

Uniprot Description

Constitutively active calcium selective cation channel thought to be involved in Ca2+ reabsorption in kidney and intestine (PubMed:11549322, PubMed:18768590). Required for normal Ca2+ reabsorption in the kidney distal convoluted tubules (). The channel is activated by low internal calcium level and the current exhibits an inward rectification (PubMed:11549322, PubMed:18768590). A Ca2+-dependent feedback regulation includes fast channel inactivation and slow current decay (). Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating ().

Research Articles on TRPV5

Similar Products

Product Notes

The TRPV5 trpv5 (Catalog #AAA3234422) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRPV5 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFLPKAEGPG SQLQKLLPSF LVREQDWDQH LDKLHMLQQK RILESPLLRA. It is sometimes possible for the material contained within the vial of "TRPV5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.