Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRPC7 blocking peptide

TRPC7 Peptide - C-terminal region

Gene Names
TRPC7; TRP7
Reactivity
Human
Synonyms
TRPC7; TRPC7 Peptide - C-terminal region; TRPC7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI
Sequence Length
746
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRPC7 blocking peptide
This is a synthetic peptide designed for use in combination with anti- TRPC7 Antibody, made

Target Description: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) (By similarity). May also be activated by intracellular calcium store depletion.
Product Categories/Family for TRPC7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
short transient receptor potential channel 7 isoform 3
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily C member 7
NCBI Official Symbol
TRPC7
NCBI Official Synonym Symbols
TRP7
NCBI Protein Information
short transient receptor potential channel 7
UniProt Protein Name
Short transient receptor potential channel 7
UniProt Gene Name
TRPC7
UniProt Synonym Gene Names
TRP7; TrpC7; TRP-7; hTRP7
UniProt Entry Name
TRPC7_HUMAN

Uniprot Description

TRPC7: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG). May also be activated by intracellular calcium store depletion. Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC7 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, calcium; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: cis-Golgi network; integral to plasma membrane; nuclear envelope; perinuclear region of cytoplasm; plasma membrane

Molecular Function: calcium channel activity; protein binding; store-operated calcium channel activity

Biological Process: cytosolic calcium ion homeostasis; manganese ion transport; platelet activation; single fertilization

Research Articles on TRPC7

Similar Products

Product Notes

The TRPC7 trpc7 (Catalog #AAA3248105) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRPC7 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQDISSLRYE LLEEKSQATG ELADLIQQLS EKFGKNLNKD HLRVNKGKDI. It is sometimes possible for the material contained within the vial of "TRPC7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.