Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

TRIM49B blocking peptide

TRIM49B Peptide - N-terminal region

Reactivity
Human
Synonyms
TRIM49B; TRIM49B Peptide - N-terminal region; TRIM49B blocking peptide
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CPIESAAEEHQEKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRL
Sequence Length
452
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for TRIM49B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
tripartite motif-containing protein
NCBI Official Synonym Full Names
tripartite motif containing 49B
NCBI Official Symbol
TRIM49B
NCBI Protein Information
tripartite motif-containing protein
UniProt Protein Name
Putative tripartite motif-containing protein 49B
UniProt Gene Name
TRIM49B
UniProt Synonym Gene Names
RNF18B
UniProt Entry Name
TR49B_HUMAN

Uniprot Description

TRIM49B: Belongs to the TRIM/RBCC family.

Chromosomal Location of Human Ortholog: 11p11.12

Similar Products

Product Notes

The TRIM49B trim49b (Catalog #AAA3231870) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRIM49B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPIESAAEEH QEKLLQKMQS LWEKACENHR NLNVETTRTR CWKDYVNLRL. It is sometimes possible for the material contained within the vial of "TRIM49B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual