TM2D2 blocking peptide
TM2D2 Peptide - middle region
Gene Names
TM2D2; BLP1
Reactivity
Human
Applications
Western Blot
Synonyms
TM2D2; TM2D2 Peptide - middle region; TM2D2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT
Sequence Length
214
Applicable Applications for TM2D2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TM2D2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TM2D2 Antibody, made
Target Description: The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades.
Target Description: The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades.
Product Categories/Family for TM2D2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
TM2 domain-containing protein 2 isoform a
NCBI Official Synonym Full Names
TM2 domain containing 2
NCBI Official Symbol
TM2D2
NCBI Official Synonym Symbols
BLP1
NCBI Protein Information
TM2 domain-containing protein 2
UniProt Protein Name
TM2 domain-containing protein 2
Protein Family
UniProt Gene Name
TM2D2
UniProt Synonym Gene Names
BLP1; BBP-like protein 1
UniProt Entry Name
TM2D2_HUMAN
NCBI Description
The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. This gene has multiple alternatively spliced transcript variants which encode two different isoforms. [provided by RefSeq, Jul 2008]
Similar Products
Product Notes
The TM2D2 tm2d2 (Catalog #AAA3239793) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TM2D2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TM2D2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TM2D2 tm2d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QELGYGCLKF GGQAYSDVEH TSVQCHALDG IECASPRTFL RENKPCIKYT. It is sometimes possible for the material contained within the vial of "TM2D2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
