Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TKFC blocking peptide

TKFC Peptide - middle region

Gene Names
TKFC; DAK; NET45
Reactivity
Human
Synonyms
TKFC; TKFC Peptide - middle region; TKFC blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAA
Sequence Length
575
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TKFC blocking peptide
This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for TKFC blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
triokinase/FMN cyclase isoform b
NCBI Official Synonym Full Names
triokinase and FMN cyclase
NCBI Official Symbol
TKFC
NCBI Official Synonym Symbols
DAK; NET45
NCBI Protein Information
triokinase/FMN cyclase
UniProt Protein Name
Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
Protein Family
UniProt Gene Name
DAK
UniProt Synonym Gene Names
DHA kinase
UniProt Entry Name
DHAK_HUMAN

NCBI Description

This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2017]

Uniprot Description

DAK: Catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate. Belongs to the dihydroxyacetone kinase (DAK) family.

Protein type: EC 2.7.1.29; Lipid Metabolism - glycerolipid; Kinase, other; EC 4.6.1.15; EC 2.7.1.28

Chromosomal Location of Human Ortholog: 11q12.2

Cellular Component: nucleus; cytosol

Molecular Function: metal ion binding; FAD-AMP lyase (cyclizing) activity; triokinase activity; ATP binding; glycerone kinase activity

Biological Process: glycerol metabolic process; carbohydrate phosphorylation; innate immune response; cellular carbohydrate metabolic process; regulation of innate immune response

Research Articles on TKFC

Similar Products

Product Notes

The TKFC dak (Catalog #AAA3246377) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TKFC Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMQKYGKAAP GDRTMLDSLW AAGQELQAWK SPGADLLQVL TKAVKSAEAA. It is sometimes possible for the material contained within the vial of "TKFC, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.