Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TJP3 blocking peptide

TJP3 Peptide-middle region

Gene Names
TJP3; ZO3; ZO-3
Reactivity
Human
Synonyms
TJP3; TJP3 Peptide-middle region; ZO3; ZO-3; TJP3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GRDLREQERGIIPNQSRAEQLASLEAAQRAVGVGPGSSAGSNARAEFWRL
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
933 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TJP3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TJP3 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: The protein encoded by this gene is a member of the membrane-associated guanylate kinase-like (MAGUK) protein family which is characterized by members having multiple PDZ domains, a single SH3 domain, and a single guanylate kinase-like (GUK)-domain. In addition, members of the zonula occludens protein subfamily have an acidic domain, a basic arginine-rich region, and a proline-rich domain. The protein encoded by this gene plays a role in the linkage between the actin cytoskeleton and tight-junctions and also sequesters cyclin D1 at tight junctions during mitosis. Alternative splicing results in multiple transcript variants encoding distinct isoforms. This gene has a partial pseudogene on chromosome 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
97,488 Da
NCBI Official Full Name
Tight junction protein ZO-3
NCBI Official Synonym Full Names
tight junction protein 3
NCBI Official Symbol
TJP3
NCBI Official Synonym Symbols
ZO3; ZO-3
NCBI Protein Information
tight junction protein ZO-3; zona occludens protein 3; zonula occludens protein 3; tight junction protein 3 (zona occludens 3)
UniProt Protein Name
Tight junction protein ZO-3
Protein Family
UniProt Gene Name
TJP3
UniProt Synonym Gene Names
ZO3
UniProt Entry Name
ZO3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the membrane-associated guanylate kinase-like (MAGUK) protein family which is characterized by members having multiple PDZ domains, a single SH3 domain, and a single guanylate kinase-like (GUK)-domain. In addition, members of the zonula occludens protein subfamily have an acidic domain, a basic arginine-rich region, and a proline-rich domain. The protein encoded by this gene plays a role in the linkage between the actin cytoskeleton and tight-junctions and also sequesters cyclin D1 at tight junctions during mitosis. Alternative splicing results in multiple transcript variants encoding distinct isoforms. This gene has a partial pseudogene on chromosome 1. [provided by RefSeq, May 2012]

Uniprot Description

ZO3: Interacts with occludin, claudins and ZO-1. Interacts with INADL. Interacts with UBN1. Interacts with FASLG. Belongs to the MAGUK family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; tight junction; apical plasma membrane; cell junction; nucleus

Molecular Function: protein binding

Research Articles on TJP3

Similar Products

Product Notes

The TJP3 tjp3 (Catalog #AAA3249313) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TJP3 Peptide-middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: GRDLREQERG IIPNQSRAEQ LASLEAAQRA VGVGPGSSAG SNARAEFWRL. It is sometimes possible for the material contained within the vial of "TJP3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.