Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TICAM2 blocking peptide

TICAM2 Peptide - N-terminal region

Gene Names
TICAM2; TIRP; TRAM; TIRAP3; MyD88-4; TICAM-2
Reactivity
Human
Applications
Western Blot
Synonyms
TICAM2; TICAM2 Peptide - N-terminal region; TICAM2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEE
Sequence Length
235
Applicable Applications for TICAM2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TICAM2 blocking peptide
This locus represents naturally occurring read-through transcription between the neighboring transmembrane emp24 protein transport domain containing 7 (TMED7) and toll-like receptor adaptor molecule 2 (TICAM2) genes. Alternative splicing results in multiple transcript variants, one of which encodes a fusion protein that shares sequence identity with the products of each individual gene. This fusion product functions to negatively regulate the adaptor MyD88-independent toll-like receptor 4 pathway.
Product Categories/Family for TICAM2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
TIR domain-containing adapter molecule 2
NCBI Official Synonym Full Names
toll like receptor adaptor molecule 2
NCBI Official Symbol
TICAM2
NCBI Official Synonym Symbols
TIRP; TRAM; TIRAP3; MyD88-4; TICAM-2
NCBI Protein Information
TIR domain-containing adapter molecule 2
UniProt Protein Name
TIR domain-containing adapter molecule 2
UniProt Gene Name
TICAM2
UniProt Synonym Gene Names
TIRAP3; TIRP; TRAM; TICAM-2; MyD88-4
UniProt Entry Name
TCAM2_HUMAN

NCBI Description

TIRP is a Toll/interleukin-1 receptor (IL1R; MIM 147810) (TIR) domain-containing adaptor protein involved in Toll receptor signaling (see TLR4; MIM 603030).[supplied by OMIM, Apr 2004]

Uniprot Description

TICAM2: a toll-like receptor adapter that participates in induction of type 1 interferons. Transiently phosphorylated on serine-16 during LPS/Toll-like receptor 4 (TLR4) signaling. Activated TLR4 associates with four adapter proteins, MyD88, TIRAP, TICAM-1 (Trif), and TICAM-2.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5q23.1

Cellular Component: Golgi apparatus; early endosome membrane; endoplasmic reticulum; late endosome membrane; early endosome; late endosome; plasma membrane; endosome membrane

Molecular Function: signal transducer activity; phospholipid binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; positive regulation of interferon-gamma production; positive regulation of I-kappaB kinase/NF-kappaB cascade; MyD88-independent toll-like receptor signaling pathway; negative regulation of toll-like receptor 4 signaling pathway; toll-like receptor signaling pathway; positive regulation of toll-like receptor 4 signaling pathway; positive regulation of interleukin-6 production; innate immune response; toll-like receptor 3 signaling pathway; inflammatory response; toll-like receptor 4 signaling pathway

Research Articles on TICAM2

Similar Products

Product Notes

The TICAM2 ticam2 (Catalog #AAA3241479) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TICAM2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TICAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TICAM2 ticam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VDTSPGYHES DSKKSEDLSL CNVAEHSNTT EGPTGKQEGA QSVEEMFEEE. It is sometimes possible for the material contained within the vial of "TICAM2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.