Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TGFBR1 blocking peptide

TGFBR1 Peptide - middle region

Gene Names
TGFBR1; AAT5; ALK5; ESS1; LDS1; MSSE; SKR4; TBRI; ALK-5; LDS1A; LDS2A; TBR-i; TGFR-1; ACVRLK4; tbetaR-I
Reactivity
Human
Synonyms
TGFBR1; TGFBR1 Peptide - middle region; TGFBR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIY
Sequence Length
503
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TGFBR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- TGFBR1 Antibody, made

Target Description: The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for TGFBR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
TGF-beta receptor type-1 isoform 2
NCBI Official Synonym Full Names
transforming growth factor beta receptor 1
NCBI Official Symbol
TGFBR1
NCBI Official Synonym Symbols
AAT5; ALK5; ESS1; LDS1; MSSE; SKR4; TBRI; ALK-5; LDS1A; LDS2A; TBR-i; TGFR-1; ACVRLK4; tbetaR-I
NCBI Protein Information
TGF-beta receptor type-1
UniProt Protein Name
TGF-beta receptor type-1
Protein Family
UniProt Gene Name
TGFBR1
UniProt Synonym Gene Names
ALK5; SKR4; TGFR-1; ALK-5; ALK5; SKR4; TGF-beta receptor type I; TbetaR-I
UniProt Entry Name
TGFR1_HUMAN

NCBI Description

The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

TGFBR1: a TKL kinase of the serine/threonine-protein kinase receptor (STKR) family. R1 and R2 TGF-beta receptors dimerize after binding TGF-beta at the cell surface. Found in all tissues; most abundant in placenta and least abundant in brain and heart.

Protein type: EC 2.7.11.30; Protein kinase, TKL; Membrane protein, integral; Protein kinase, Ser/Thr (receptor); Kinase, protein; Receptor, misc.; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: tight junction; membrane; cell; plasma membrane; endosome; receptor complex

Molecular Function: transforming growth factor beta receptor activity; protein serine/threonine kinase activity; protein binding; transforming growth factor beta receptor activity, type I; transforming growth factor beta binding; metal ion binding; growth factor binding; receptor signaling protein activity; punt binding; SMAD binding; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: lens development in camera-type eye; blastocyst development; collagen fibril organization; activation of MAPKK activity; wound healing; apoptosis; regulation of protein ubiquitination; heart development; positive regulation of transcription, DNA-dependent; negative regulation of chondrocyte differentiation; cell motility involved in cell locomotion; activin receptor signaling pathway; palate development; signal transduction; protein amino acid phosphorylation; post-embryonic development; anterior/posterior pattern formation; regulation of transcription, DNA-dependent; extracellular structure organization and biogenesis; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; germ cell migration; angiogenesis; cell cycle arrest; kidney development; skeletal development; positive regulation of filopodium formation; pharyngeal system development; thymus development; in utero embryonic development; male gonad development; peptidyl-threonine phosphorylation; neuron fate commitment; positive regulation of cell motility; embryonic cranial skeleton morphogenesis; positive regulation of cell growth; parathyroid gland development; endothelial cell activation; positive regulation of protein kinase B signaling cascade; peptidyl-serine phosphorylation; mesenchymal cell differentiation; regulation of gene expression; skeletal morphogenesis; regulation of protein binding; negative regulation of endothelial cell proliferation; endothelial cell migration; epithelial to mesenchymal transition; artery morphogenesis; positive regulation of endothelial cell proliferation; negative regulation of transforming growth factor beta receptor signaling pathway

Disease: Multiple Self-healing Squamous Epithelioma, Susceptibility To

Research Articles on TGFBR1

Similar Products

Product Notes

The TGFBR1 tgfbr1 (Catalog #AAA3247686) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TGFBR1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVCFVCISLM LMVYICHNRT VIHHRVPNEE DPSLDRPFIS EGTTLKDLIY. It is sometimes possible for the material contained within the vial of "TGFBR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.