Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TERF2IP blocking peptide

TERF2IP Peptide - middle region

Gene Names
TERF2IP; RAP1; DRIP5
Reactivity
Human
Synonyms
TERF2IP; TERF2IP Peptide - middle region; TERF2IP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPE
Sequence Length
399
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TERF2IP blocking peptide
This is a synthetic peptide designed for use in combination with anti- TERF2IP Antibody, made

Target Description: The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.
Product Categories/Family for TERF2IP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
telomeric repeat-binding factor 2-interacting protein 1
NCBI Official Synonym Full Names
TERF2 interacting protein
NCBI Official Symbol
TERF2IP
NCBI Official Synonym Symbols
RAP1; DRIP5
NCBI Protein Information
telomeric repeat-binding factor 2-interacting protein 1
UniProt Protein Name
Telomeric repeat-binding factor 2-interacting protein 1
UniProt Gene Name
TERF2IP
UniProt Synonym Gene Names
DRIP5; RAP1; TERF2-interacting telomeric protein 1; TRF2-interacting telomeric protein 1; RAP1 homolog; hRap1
UniProt Entry Name
TE2IP_HUMAN

NCBI Description

The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22. [provided by RefSeq, Apr 2010]

Uniprot Description

TERF2IP: Acts both as a regulator of telomere function and as a transcription regulator. Involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length. Does not bind DNA directly: recruited to telomeric double-stranded 5'-TTAGGG-3' repeats via its interaction with TERF2. Independently of its function in telomeres, also acts as a transcription regulator: recruited to extratelomeric 5'- TTAGGG-3' sites via its association with TERF2 or other factors, and regulates gene expression. When cytoplasmic, associates with the I-kappa-B-kinase (IKK) complex and acts as a regulator of the NF-kappa-B signaling by promoting IKK-mediated phosphorylation of RELA/p65, leading to activate expression of NF-kappa-B target genes. Associates with the I-kappa-B-kinase (IKK) core complex, composed of CHUK, IKBKB and IKBKG. Homodimer. Component of the shelterin complex (telosome) composed of TERF1, TERF2, TINF2, TERF2IP ACD and POT1. Interacts with TERF2; the interaction is direct. Does not interact with TERF1. Interacts with SLX4/BTBD12. Ubiquitous. Highly expressed. Belongs to the RAP1 family.

Protein type: DNA replication

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: nucleoplasm; nuclear chromosome; chromosome, telomeric region; nuclear telomere cap complex; Mre11 complex; nuclear chromosome, telomeric region; cytoplasm; nuclear envelope; nucleus

Molecular Function: protein binding; telomeric DNA binding

Biological Process: negative regulation of telomere maintenance; positive regulation of I-kappaB kinase/NF-kappaB cascade; regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of DNA recombination at telomere; telomere maintenance via telomerase; positive regulation of peptidyl-serine phosphorylation; telomere maintenance; activation of NF-kappaB transcription factor; protection from non-homologous end joining at telomere

Research Articles on TERF2IP

Similar Products

Product Notes

The TERF2IP terf2ip (Catalog #AAA3248030) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TERF2IP Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FEEVVVDESP PDFEIHITMC DDDPPTPEED SETQPDEEEE EEEEKVSQPE. It is sometimes possible for the material contained within the vial of "TERF2IP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.