Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TDG blocking peptide

TDG Peptide - middle region

Gene Names
TDG; hTDG
Reactivity
Human
Synonyms
TDG; TDG Peptide - middle region; TDG blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDIL
Sequence Length
410
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TDG blocking peptide
This is a synthetic peptide designed for use in combination with anti- TDG Antibody, made

Target Description: The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaired thymine. With lower activity, this enzyme also removes thymine from C/T and T/T mispairings. TDG can also remove uracil and 5-bromouracil from mispairings with guanine. This enzyme plays a central role in cellular defense against genetic mutation caused by the spontaneous deamination of 5-methylcytosine and cytosine. This gene may have a pseudogene in the p arm of chromosome 12.
Product Categories/Family for TDG blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
G/T mismatch-specific thymine DNA glycosylase isoform 1
NCBI Official Synonym Full Names
thymine DNA glycosylase
NCBI Official Symbol
TDG
NCBI Official Synonym Symbols
hTDG
NCBI Protein Information
G/T mismatch-specific thymine DNA glycosylase
UniProt Protein Name
G/T mismatch-specific thymine DNA glycosylase
UniProt Gene Name
TDG
UniProt Synonym Gene Names
hTDG
UniProt Entry Name
TDG_HUMAN

NCBI Description

The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaired thymine. With lower activity, this enzyme also removes thymine from C/T and T/T mispairings. TDG can also remove uracil and 5-bromouracil from mispairings with guanine. This enzyme plays a central role in cellular defense against genetic mutation caused by the spontaneous deamination of 5-methylcytosine and cytosine. This gene may have a pseudogene in the p arm of chromosome 12. [provided by RefSeq, Jul 2008]

Uniprot Description

TDG: In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar- phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. Belongs to the TDG/mug DNA glycosylase family.

Protein type: EC 3.2.2.29; Hydrolase; DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 12q24.1

Cellular Component: nucleoplasm; PML body; plasma membrane; nucleus

Molecular Function: protein domain specific binding; protein binding; protein homodimerization activity; structure-specific DNA binding; protein kinase C binding; SUMO binding; DNA N-glycosylase activity; double-stranded DNA binding; damaged DNA binding; transcription factor binding; pyrimidine-specific mismatch base pair DNA N-glycosylase activity; mismatched DNA binding

Biological Process: transcription from RNA polymerase II promoter; embryonic development; mismatch repair; base-excision repair, AP site formation; base-excision repair; depyrimidination; gene expression; negative regulation of transcription from RNA polymerase II promoter; chromatin modification; negative regulation of protein binding; DNA repair; regulation of gene expression, epigenetic

Research Articles on TDG

Similar Products

Product Notes

The TDG tdg (Catalog #AAA3247016) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TDG Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVESKKSGKS AKSKEKQEKI TDTFKVKRKV DRFNGVSEAE LLTKTLPDIL. It is sometimes possible for the material contained within the vial of "TDG, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.