Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SPINK9 blocking peptide

SPINK9 Peptide - middle region

Gene Names
SPINK9; LEKTI2
Reactivity
Human
Applications
Western Blot
Synonyms
SPINK9; SPINK9 Peptide - middle region; SPINK9 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFG
Sequence Length
107
Applicable Applications for SPINK9 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SPINK9 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SPINK9 Antibody, made

Target Description: SPINK9 is a serine protease inhibitor which specifically inhibits KLK5. It may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.
Product Categories/Family for SPINK9 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
serine protease inhibitor Kazal-type 9
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kazal type 9
NCBI Official Symbol
SPINK9
NCBI Official Synonym Symbols
LEKTI2
NCBI Protein Information
serine protease inhibitor Kazal-type 9
UniProt Protein Name
Serine protease inhibitor Kazal-type 9
Protein Family
UniProt Gene Name
SPINK9
UniProt Synonym Gene Names
LEKTI2
UniProt Entry Name
ISK9_HUMAN

NCBI Description

The protein encoded by this gene is a Kazal-type serine protease inhibitor that appears to specifically target kallikrein-related peptidase 5 (KLK5) in the palmo-plantar epidermis. KLK5 is an important initiator of skin desquamation, so the encoded protease inhibitor may regulate skin differentiation in the palms of hands and soles of feet. This cationic protein has also been shown to promote keratinocyte migration by activation of the epidermal growth factor receptor (EGFR). [provided by RefSeq, Dec 2015]

Research Articles on SPINK9

Similar Products

Product Notes

The SPINK9 spink9 (Catalog #AAA3242333) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SPINK9 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPINK9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPINK9 spink9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKKLPPGQQR FCHHMYDPIC GSDGKTYKND CFFCSKVKKT DGTLKFVHFG. It is sometimes possible for the material contained within the vial of "SPINK9, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.