Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC6A15 blocking peptide

SLC6A15 Peptide - middle region

Gene Names
SLC6A15; V7-3; NTT73; SBAT1; hv7-3
Reactivity
Human
Applications
Western Blot
Synonyms
SLC6A15; SLC6A15 Peptide - middle region; SLC6A15 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS
Sequence Length
730
Applicable Applications for SLC6A15 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC6A15 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC6A15 Antibody, made

Target Description: SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.
Product Categories/Family for SLC6A15 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
sodium-dependent neutral amino acid transporter B(0)AT2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 6 member 15
NCBI Official Symbol
SLC6A15
NCBI Official Synonym Symbols
V7-3; NTT73; SBAT1; hv7-3
NCBI Protein Information
sodium-dependent neutral amino acid transporter B(0)AT2
UniProt Protein Name
Sodium-dependent neutral amino acid transporter B(0)AT2
UniProt Gene Name
SLC6A15
UniProt Synonym Gene Names
B0AT2; NTT73; SBAT1
UniProt Entry Name
S6A15_HUMAN

NCBI Description

This gene encodes a member of the solute carrier family 6 protein family which transports neutral amino acids. The encoded protein is thought to play a role in neuronal amino acid transport (PMID: 16185194) and may be associated with major depression (PMID: 21521612). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

SLC6A15: Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A15 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 12q21.3

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: proline:sodium symporter activity; neurotransmitter:sodium symporter activity; neurotransmitter transporter activity

Biological Process: leucine transport; neutral amino acid transport; neurotransmitter transport; amino acid transport; sodium ion transport; ion transport; proline transport; transmembrane transport

Research Articles on SLC6A15

Similar Products

Product Notes

The SLC6A15 slc6a15 (Catalog #AAA3232205) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC6A15 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC6A15 slc6a15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YISPLMLLSL LIASVVNMGL SPPGYNAWIE DKASEEFLSY PTWGLVVCVS. It is sometimes possible for the material contained within the vial of "SLC6A15, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.