SLC50A1 blocking peptide
SLC50A1 Peptide - C-terminal region
Gene Names
SLC50A1; SCP; slv; SWEET1; RAG1AP1; HsSWEET1
Reactivity
Human
Applications
Western Blot
Synonyms
SLC50A1; SLC50A1 Peptide - C-terminal region; SLC50A1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM
Sequence Length
221
Applicable Applications for SLC50A1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC50A1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC50A1 Antibody, made
Target Description: SLC50A1 mediates sugar transport across membranes. It may stimulate V(D)J recombination by the activation of RAG1.
Target Description: SLC50A1 mediates sugar transport across membranes. It may stimulate V(D)J recombination by the activation of RAG1.
Product Categories/Family for SLC50A1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
sugar transporter SWEET1 isoform a
NCBI Official Synonym Full Names
solute carrier family 50 member 1
NCBI Official Symbol
SLC50A1
NCBI Official Synonym Symbols
SCP; slv; SWEET1; RAG1AP1; HsSWEET1
NCBI Protein Information
sugar transporter SWEET1
UniProt Protein Name
Sugar transporter SWEET1
UniProt Gene Name
SLC50A1
UniProt Synonym Gene Names
RAG1AP1; SCP; HsSWEET1
UniProt Entry Name
SWET1_HUMAN
Uniprot Description
RAG1AP1: Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1. Belongs to the SWEET sugar transporter family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 1q22
Cellular Component: endomembrane system; Golgi apparatus; Golgi membrane; integral to membrane; nucleus; plasma membrane
Molecular Function: glucoside transmembrane transporter activity; sugar transmembrane transporter activity
Biological Process: carbohydrate transport; glucoside transport; positive regulation of gene expression, epigenetic
Similar Products
Product Notes
The SLC50A1 slc50a1 (Catalog #AAA3240695) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC50A1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC50A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC50A1 slc50a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SMYLSPLADL AKVIQTKSTQ CLSYPLTIAT LLTSASWCLY GFRLRDPYIM. It is sometimes possible for the material contained within the vial of "SLC50A1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
