Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SIRT2 blocking peptide

SIRT2 Peptide - C-terminal region

Gene Names
SIRT2; SIR2; SIR2L; SIR2L2
Reactivity
Human
Synonyms
SIRT2; SIRT2 Peptide - C-terminal region; SIRT2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPA
Sequence Length
369
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SIRT2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- SIRT2 Antibody, made

Target Description: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.
Product Categories/Family for SIRT2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
NAD-dependent protein deacetylase sirtuin-2 isoform 3
NCBI Official Synonym Full Names
sirtuin 2
NCBI Official Symbol
SIRT2
NCBI Official Synonym Symbols
SIR2; SIR2L; SIR2L2
NCBI Protein Information
NAD-dependent protein deacetylase sirtuin-2
UniProt Protein Name
NAD-dependent protein deacetylase sirtuin-2
UniProt Gene Name
SIRT2
UniProt Synonym Gene Names
SIR2L; SIR2L2
UniProt Entry Name
SIR2_HUMAN

NCBI Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

SIRT2: NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and non-histone proteins. Deacetylates 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton. Deacetylates PCK1, opposing proteasomal degradation. Deacetylates 'Lys-310' of RELA. Interacts with HDAC6, suggesting that these proteins belong to a large complex that deacetylate the cytoskeleton. Widely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network. Inhibited by Sirtinol, A3 and M15 small molecules. Inhibited by nicotinamide. Belongs to the sirtuin family. Class I subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Deacetylase; EC 3.5.1.-

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: microtubule; centrosome; lateral loop; paranode region of axon; perikaryon; nuclear heterochromatin; chromosome; cytosol; centriole; chromatin silencing complex; growth cone; perinuclear region of cytoplasm; cytoplasm; plasma membrane; spindle; midbody; nucleus; myelin sheath

Molecular Function: ubiquitin binding; zinc ion binding; histone deacetylase binding; protein deacetylase activity; beta-tubulin binding; transcription factor binding; histone acetyltransferase binding; protein binding; tubulin deacetylase activity; NAD-dependent histone deacetylase activity; NAD-dependent histone deacetylase activity (H4-K16 specific); chromatin binding; histone deacetylase activity; NAD+ ADP-ribosyltransferase activity

Biological Process: chromatin silencing at rDNA; proteasomal ubiquitin-dependent protein catabolic process; negative regulation of autophagy; phosphoinositide 3-kinase cascade; regulation of myelination; regulation of cell cycle; chromatin silencing; positive regulation of attachment of spindle microtubules to kinetochore; response to redox state; gene silencing; negative regulation of transcription from RNA polymerase II promoter; chromatin silencing at telomere; negative regulation of cell proliferation; substantia nigra development; meiotic cell cycle; protein amino acid deacetylation; cellular lipid catabolic process; protein kinase B signaling cascade; positive regulation of DNA binding; mitosis; regulation of phosphorylation; positive regulation of meiosis; transcription, DNA-dependent; regulation of exit from mitosis; hepatocyte growth factor receptor signaling pathway; histone deacetylation; negative regulation of striated muscle development; negative regulation of fat cell differentiation; myelination in the peripheral nervous system; protein amino acid ADP-ribosylation; cell division; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of cell division; autophagy; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of protein catabolic process

Research Articles on SIRT2

Similar Products

Product Notes

The SIRT2 sirt2 (Catalog #AAA3247793) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SIRT2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCLALAELLG WKKELEDLVR REHASIDAQS GAGVPNPSTS ASPKKSPPPA. It is sometimes possible for the material contained within the vial of "SIRT2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.