Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RTEL1 blocking peptide

RTEL1 Peptide - C-terminal region

Gene Names
RTEL1; NHL; RTEL; DKCA4; DKCB5; PFBMFT3; C20orf41
Reactivity
Human
Applications
Western Blot
Synonyms
RTEL1; RTEL1 Peptide - C-terminal region; RTEL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRALGS
Sequence Length
996
Applicable Applications for RTEL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RTEL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RTEL1 Antibody, made

Target Description: This gene encodes a DNA helicase which functions in the stability, protection and elongation of telomeres and interacts with proteins in the shelterin complex known to protect telomeres during DNA replication. Mutations in this gene have been associated with dyskeratosis congenita and Hoyerall-Hreidarsson syndrome. Read-through transcription of this gene into the neighboring downstream gene, which encodes tumor necrosis factor receptor superfamily, member 6b, generates a non-coding transcript. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for RTEL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
regulator of telomere elongation helicase 1 isoform 1
NCBI Official Synonym Full Names
regulator of telomere elongation helicase 1
NCBI Official Symbol
RTEL1
NCBI Official Synonym Symbols
NHL; RTEL; DKCA4; DKCB5; PFBMFT3; C20orf41
NCBI Protein Information
regulator of telomere elongation helicase 1
UniProt Protein Name
Regulator of telomere elongation helicase 1
UniProt Gene Name
RTEL1
UniProt Entry Name
RTEL1_HUMAN

NCBI Description

This gene encodes a DNA helicase which functions in the stability, protection and elongation of telomeres and interacts with proteins in the shelterin complex known to protect telomeres during DNA replication. Mutations in this gene have been associated with dyskeratosis congenita and Hoyerall-Hreidarsson syndrome. Read-through transcription of this gene into the neighboring downstream gene, which encodes tumor necrosis factor receptor superfamily, member 6b, generates a non-coding transcript. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]

Uniprot Description

RTEL1: ATP-dependent DNA helicase required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. Antagonizes homologous recombination by promoting the disassembly of D loop recombination intermediates. Also required to regulate telomere length; probably due to its anti-recombinase function. Belongs to the helicase family. RAD3/XPD subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.4.12; DNA repair, damage; Helicase

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; 4 iron, 4 sulfur cluster binding; metal ion binding; ATP binding

Biological Process: DNA repair; telomere maintenance; DNA duplex unwinding

Disease: Dyskeratosis Congenita, Autosomal Recessive, 5; Pulmonary Fibrosis And/or Bone Marrow Failure, Telomere-related, 3

Research Articles on RTEL1

Similar Products

Product Notes

The RTEL1 rtel1 (Catalog #AAA3244450) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RTEL1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RTEL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RTEL1 rtel1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGRPHLSPRP PPTGDPGSQP QWGSGVPRAG KQGQHAVSAY LADARRALGS. It is sometimes possible for the material contained within the vial of "RTEL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.