Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RANGRF blocking peptide

RANGRF Peptide - C-terminal region

Gene Names
RANGRF; MOG1; HSPC165; HSPC236; RANGNRF
Reactivity
Human
Synonyms
RANGRF; RANGRF Peptide - C-terminal region; RANGRF blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLV
Sequence Length
186
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RANGRF blocking peptide
This gene encodes a protein that has been shown to function as a guanine nucleotide release factor in mouse and to regulate the expression and function of the Nav1.5 cardiac sodium channel in human. Alternative splicing results in multiple transcript variants.
Product Categories/Family for RANGRF blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ran guanine nucleotide release factor isoform B
NCBI Official Synonym Full Names
RAN guanine nucleotide release factor
NCBI Official Symbol
RANGRF
NCBI Official Synonym Symbols
MOG1; HSPC165; HSPC236; RANGNRF
NCBI Protein Information
ran guanine nucleotide release factor
UniProt Protein Name
Ran guanine nucleotide release factor
UniProt Gene Name
RANGRF
UniProt Synonym Gene Names
MOG1; RANGNRF; RanGNRF
UniProt Entry Name
MOG1_HUMAN

NCBI Description

This gene encodes a protein that has been shown to function as a guanine nucleotide release factor in mouse and to regulate the expression and function of the Nav1.5 cardiac sodium channel in human. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Uniprot Description

RANGRF: May regulate the intracellular trafficking of RAN. In cardiac cells seems to regulate the cell surface localization of SCN5A. Belongs to the MOG1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs, misc.; GEFs

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: nucleoplasm; rough endoplasmic reticulum; cytoplasm; plasma membrane; caveola; nucleus

Molecular Function: sodium channel regulator activity; Ran guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; Ran GTPase binding; protein transporter activity

Biological Process: regulation of membrane potential; ER to Golgi vesicle-mediated transport; protein exit from endoplasmic reticulum; regulation of heart rate

Research Articles on RANGRF

Similar Products

Product Notes

The RANGRF rangrf (Catalog #AAA3244885) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RANGRF Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLHQALLRLP QYQTDLLLTF NQPPPDNRSS LGPENLSPAP WSLGDFEQLV. It is sometimes possible for the material contained within the vial of "RANGRF, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.