Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PRDM6 blocking peptide

PRDM6 Peptide - C-terminal region

Gene Names
PRDM6; PDA3; KMT8C; PRISM
Reactivity
Human
Applications
Western Blot
Synonyms
PRDM6; PRDM6 Peptide - C-terminal region; PRDM6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE
Sequence Length
413
Applicable Applications for PRDM6 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PRDM6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PRDM6 Antibody, made

Target Description: PRDM6 contains 4 C2H2-type zinc fingers and 1 SET domain. PRDM6 may be involved in transcriptional regulation.
Product Categories/Family for PRDM6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
putative histone-lysine N-methyltransferase PRDM6
NCBI Official Synonym Full Names
PR/SET domain 6
NCBI Official Symbol
PRDM6
NCBI Official Synonym Symbols
PDA3; KMT8C; PRISM
NCBI Protein Information
putative histone-lysine N-methyltransferase PRDM6
UniProt Protein Name
Putative histone-lysine N-methyltransferase PRDM6
UniProt Gene Name
PRDM6
UniProt Synonym Gene Names
PFM3

NCBI Description

The protein encoded by this gene is a transcriptional repressor and a member of the PRDM family. Family members contain a PR domain and multiple zinc-finger domains. The encoded protein is involved in regulation of vascular smooth muscle cells (VSMC) contractile proteins. Mutations in this gene result in patent ductus arteriosus 3 (PDA3). [provided by RefSeq, Apr 2017]

Uniprot Description

PRDM6: Putative histone methyltransferase that acts as a transcriptional repressor of smooth muscle gene expression. Promotes the transition from differentiated to proliferative smooth muscle by suppressing differentiation and maintaining the proliferative potential of vascular smooth muscle cells. Also plays a role in endothelial cells by inhibiting endothelial cell proliferation, survival and differentiation. It is unclear whether it has histone methyltransferase activity in vivo. According to some authors, it does not act as a histone methyltransferase by itself and represses transcription by recruiting EHMT2/G9a. According to others, it possesses histone methyltransferase activity when associated with other proteins and specifically methylates 'Lys-20' of histone H4 in vitro. 'Lys-20' methylation represents a specific tag for epigenetic transcriptional repression. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; Cell development/differentiation; EC 2.1.1.43; Methyltransferase; Methyltransferase, protein lysine

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: nucleus

Molecular Function: histone-lysine N-methyltransferase activity; metal ion binding; nucleic acid binding; protein homodimerization activity

Biological Process: negative regulation of smooth muscle cell differentiation; negative regulation of transcription, DNA-dependent; neurogenesis; transcription, DNA-dependent

Disease: Patent Ductus Arteriosus 3

Research Articles on PRDM6

Similar Products

Product Notes

The PRDM6 prdm6 (Catalog #AAA3228042) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PRDM6 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRDM6 prdm6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FAGATTLNNH IRTHTGEKPF KCERCERSFT QATQLSRHQR MPNECKPITE. It is sometimes possible for the material contained within the vial of "PRDM6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.