Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PRDM16 blocking peptide

PRDM16 Peptide - middle region

Gene Names
PRDM16; MEL1; KMT8F; LVNC8; PFM13; CMD1LL
Reactivity
Human
Synonyms
PRDM16; PRDM16 Peptide - middle region; PRDM16 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLPQV
Sequence Length
1092
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PRDM16 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PRDM16 Antibody, made

Target Description: The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for PRDM16 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120 kDa
NCBI Official Full Name
PR domain zinc finger protein 16 isoform 1
NCBI Official Synonym Full Names
PR/SET domain 16
NCBI Official Symbol
PRDM16
NCBI Official Synonym Symbols
MEL1; KMT8F; LVNC8; PFM13; CMD1LL
NCBI Protein Information
PR domain zinc finger protein 16
UniProt Protein Name
PR domain zinc finger protein 16
UniProt Gene Name
PRDM16
UniProt Synonym Gene Names
KIAA1675; MEL1; PFM13; MDS1/EVI1-like gene 1
UniProt Entry Name
PRD16_HUMAN

NCBI Description

The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

PRDM16: binds DNA and functions as a transcriptional regulator. A repressor of TGF-beta signaling. Functions in the differentiation of brown adipose tissue (BAT) which is specialized in dissipating chemical energy in the form of heat in response to cold or excess feeding while white adipose tissue (WAT) is specialized in the storage of excess energy and the control of systemic metabolism. Together with CEBPB, regulates the differentiation of myoblastic precursors into brown adipose cells. Interacts with HDAC1, SKI, SMAD2 and SMAD3; the interaction with SKI promotes the recruitment of SMAD3-HDAC1 complex on the promoter of TGF-beta target genes. A chromosomal aberration involving PRDM16 is found in myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). Reciprocal translocation t(1;3)(p36;q21). Isoform 4 is specifically expressed in adult T-cell leukemia. Four human isoforms are produced by alternative promoter usage and alternative splicing

Protein type: Methyltransferase, protein lysine, predicted; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 1p36.23-p33

Cellular Component: transcriptional repressor complex; nucleus

Molecular Function: protein binding; transcription activator binding; sequence-specific DNA binding; metal ion binding; transcription coactivator activity; SMAD binding

Biological Process: regulation of cellular respiration; tongue development; neurogenesis; transcription, DNA-dependent; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; white fat cell differentiation; brown fat cell differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of transforming growth factor beta receptor signaling pathway; negative regulation of granulocyte differentiation

Disease: Left Ventricular Noncompaction 8

Research Articles on PRDM16

Similar Products

Product Notes

The PRDM16 prdm16 (Catalog #AAA3246288) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PRDM16 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAPASGEEQP LDLSIGSRAR ASQNGGGREP RKNHVYGERK LGAGEGLPQV. It is sometimes possible for the material contained within the vial of "PRDM16, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.