Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PPP1R1C blocking peptide

PPP1R1C Peptide - C-terminal region

Gene Names
PPP1R1C; IPP5
Reactivity
Human
Applications
Western Blot
Synonyms
PPP1R1C; PPP1R1C Peptide - C-terminal region; PPP1R1C blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD
Sequence Length
109
Applicable Applications for PPP1R1C blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PPP1R1C blocking peptide
This is a synthetic peptide designed for use in combination with anti-PPP1R1C Antibody, made

Target Description: Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation.
Product Categories/Family for PPP1R1C blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 1C isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 1C
NCBI Official Symbol
PPP1R1C
NCBI Official Synonym Symbols
IPP5
NCBI Protein Information
protein phosphatase 1 regulatory subunit 1C
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 1C
UniProt Gene Name
PPP1R1C
UniProt Synonym Gene Names
IPP5
UniProt Entry Name
PPR1C_HUMAN

NCBI Description

Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]

Uniprot Description

PPP1R1C: Inhibitor of protein-phosphatase 1. Promotes cell growth and cell cycle progress at the G1/S transition. May increase cell susceptibility to TNF-induced apoptosis. Belongs to the protein phosphatase inhibitor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 2q31.3

Cellular Component: cytoplasm

Molecular Function: protein phosphatase inhibitor activity; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: cell division; negative regulation of protein kinase activity; cell cycle; positive regulation of cell growth

Research Articles on PPP1R1C

Similar Products

Product Notes

The PPP1R1C ppp1r1c (Catalog #AAA3242180) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PPP1R1C Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R1C ppp1r1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GELQNASPKQ RKQSVYTPPT IKGVKHLKGQ NESAFPEEEE GTNEREEQRD. It is sometimes possible for the material contained within the vial of "PPP1R1C, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.