Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PLCG2 blocking peptide

PLCG2 Peptide - middle region

Gene Names
PLCG2; FCAS3; APLAID; PLC-IV; PLC-gamma-2
Reactivity
Human
Applications
Western Blot
Synonyms
PLCG2; PLCG2 Peptide - middle region; PLCG2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGA
Sequence Length
1265
Applicable Applications for PLCG2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLCG2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PLCG2 Antibody, made

Target Description: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG), using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane.
Product Categories/Family for PLCG2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
139kDa
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
NCBI Official Synonym Full Names
phospholipase C gamma 2
NCBI Official Symbol
PLCG2
NCBI Official Synonym Symbols
FCAS3; APLAID; PLC-IV; PLC-gamma-2
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
UniProt Gene Name
PLCG2
UniProt Synonym Gene Names
PLC-IV; PLC-gamma-2
UniProt Entry Name
PLCG2_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3. [provided by RefSeq, Mar 2014]

Uniprot Description

PLCG2: a calcium dependent phosphatidylinositol-specific phospholipase C. The activated enzyme produces the second messenger molecules diacylglycerol and inositol 1,4,5-trisphosphate. It is a crucial enzyme in transmembrane signaling. Phosphorylated and activated by tyrosine kinases in response to signaling through a variety of growth factor receptors and immune system receptors.

Protein type: Motility/polarity/chemotaxis; Carbohydrate Metabolism - inositol phosphate; EC 3.1.4.11; Phospholipase

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: plasma membrane; cytosol

Molecular Function: protein binding; signal transducer activity; phospholipase C activity; phosphoinositide phospholipase C activity

Biological Process: platelet activation; Wnt receptor signaling pathway; inositol phosphate metabolic process; phospholipid catabolic process; calcium-mediated signaling; response to lipopolysaccharide; T cell receptor signaling pathway; B cell receptor signaling pathway; activation of store-operated calcium channel activity; inositol trisphosphate biosynthetic process; regulation of gene expression; B cell differentiation; release of sequestered calcium ion into cytosol; negative regulation of programmed cell death; phosphatidylinositol biosynthetic process; innate immune response; follicular B cell differentiation; blood coagulation

Disease: Autoinflammation, Antibody Deficiency, And Immune Dysregulation, Plcg2-associated; Familial Cold Autoinflammatory Syndrome 3

Research Articles on PLCG2

Similar Products

Product Notes

The PLCG2 plcg2 (Catalog #AAA3244131) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLCG2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLCG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLCG2 plcg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETHLRCAEFE LRLTDPVPNP NPHESKPWYY DSLSRGEAED MLMRIPRDGA. It is sometimes possible for the material contained within the vial of "PLCG2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.