Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PLCG1 blocking peptide

PLCG1 Peptide - N-terminal region

Gene Names
PLCG1; PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1
Reactivity
Human
Synonyms
PLCG1; PLCG1 Peptide - N-terminal region; PLCG1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFR
Sequence Length
1290
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLCG1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PLCG1 Antibody, made

Target Description: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for PLCG1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141 kDa
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform a
NCBI Official Synonym Full Names
phospholipase C gamma 1
NCBI Official Symbol
PLCG1
NCBI Official Synonym Symbols
PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
UniProt Gene Name
PLCG1
UniProt Synonym Gene Names
PLC1; PLC-II; PLC-gamma-1
UniProt Entry Name
PLCG1_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PLCG1: a calcium dependent phosphatidylinositol-specific phospholipase C. The activated enzyme produces the second messenger molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylated and activated by tyrosine kinases in response to signaling through a variety of growth factor receptors and immune system receptors.

Protein type: EC 3.1.4.11; Carbohydrate Metabolism - inositol phosphate; Motility/polarity/chemotaxis; Phospholipase

Chromosomal Location of Human Ortholog: 20q12-q13.1

Cellular Component: signalosome; ruffle; cell projection; lamellipodium; cytoplasm; plasma membrane; intercellular junction; cytosol

Molecular Function: protein binding; glutamate receptor binding; neurotrophin TRKA receptor binding; receptor signaling protein activity; calcium ion binding; receptor tyrosine kinase binding; phospholipase C activity; protein kinase binding; phosphoinositide phospholipase C activity

Biological Process: epidermal growth factor receptor signaling pathway; axon guidance; cell migration; inositol phosphate metabolic process; fibroblast growth factor receptor signaling pathway; viral reproduction; nerve growth factor receptor signaling pathway; activation of MAPKK activity; in utero embryonic development; phospholipid catabolic process; cytokine and chemokine mediated signaling pathway; positive regulation of blood vessel endothelial cell migration; calcium-mediated signaling; signal transduction; T cell receptor signaling pathway; positive regulation of angiogenesis; phospholipase C activation; innate immune response; positive regulation of release of sequestered calcium ion into cytosol; vascular endothelial growth factor receptor signaling pathway; blood coagulation; leukocyte migration

Research Articles on PLCG1

Similar Products

Product Notes

The PLCG1 plcg1 (Catalog #AAA3247102) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLCG1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DKIEGAIDIR EIKEIRPGKT SRDFDRYQED PAFRPDQSHC FVILYGMEFR. It is sometimes possible for the material contained within the vial of "PLCG1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.