Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NOVA2 blocking peptide

NOVA2 Peptide - middle region

Gene Names
NOVA2; ANOVA; NOVA3
Reactivity
Human
Applications
Western Blot
Synonyms
NOVA2; NOVA2 Peptide - middle region; NOVA2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLS
Sequence Length
492
Applicable Applications for NOVA2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for NOVA2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
RNA-binding protein Nova-2
NCBI Official Synonym Full Names
NOVA alternative splicing regulator 2
NCBI Official Symbol
NOVA2
NCBI Official Synonym Symbols
ANOVA; NOVA3
NCBI Protein Information
RNA-binding protein Nova-2
UniProt Protein Name
RNA-binding protein Nova-2
Protein Family
UniProt Gene Name
NOVA2
UniProt Synonym Gene Names
ANOVA; NOVA3
UniProt Entry Name
NOVA2_HUMAN

Uniprot Description

NOVA2: May regulate RNA splicing or metabolism in a specific subset of developing neurons. Binds single strand RNA.

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleus

Molecular Function: RNA binding

Biological Process: regulation of RNA metabolic process

Research Articles on NOVA2

Similar Products

Product Notes

The NOVA2 nova2 (Catalog #AAA3245142) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NOVA2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOVA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOVA2 nova2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILQPQTTMNP DRAKQAKLIV PNSTAGLIIG KGGATVKAVM EQSGAWVQLS. It is sometimes possible for the material contained within the vial of "NOVA2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.