Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NFATC4 blocking peptide

NFATC4 Peptide - N-terminal region

Gene Names
NFATC4; NFAT3; NF-AT3; NF-ATC4
Reactivity
Human
Applications
Western Blot
Synonyms
NFATC4; NFATC4 Peptide - N-terminal region; NFATC4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PSIRITSISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGG
Sequence Length
782
Applicable Applications for NFATC4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NFATC4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NFATC4 Antibody, made

Target Description: This gene encodes a member of the nuclear factor of activated T cells (NFAT) protein family. The encoded protein is part of a DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor stimulation and an inducible nuclear component. NFAT proteins are activated by the calmodulin-dependent phosphatase, calcineurin. The encoded protein plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of interleukin-2 and interleukin-4. Alternative splicing results in multiple transcript variants.
Product Categories/Family for NFATC4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Synonym Full Names
nuclear factor of activated T cells 4
NCBI Official Symbol
NFATC4
NCBI Official Synonym Symbols
NFAT3; NF-AT3; NF-ATC4
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 4
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 4
UniProt Gene Name
NFATC4
UniProt Synonym Gene Names
NFAT3; NF-ATc4; NFATc4; NF-AT3
UniProt Entry Name
NFAC4_HUMAN

NCBI Description

This gene encodes a member of the nuclear factor of activated T cells (NFAT) protein family. The encoded protein is part of a DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor stimulation and an inducible nuclear component. NFAT proteins are activated by the calmodulin-dependent phosphatase, calcineurin. The encoded protein plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of interleukin-2 and interleukin-4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

NFAT3: a transcription factor that plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4. Also control gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of lymphoid and nonlymphoid cells. Highly expressed in placenta, lung, kidney, testis and ovary. Weakly expressed in spleen and thymus. Not expressed in peripheral blood lymphocytes. 23 alternatively spliced isoforms of the human protein hve been reported. Note: This description may include information from UniProtKB

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: transcription factor complex; intermediate filament cytoskeleton; cytoplasm; nucleus; cytosol

Molecular Function: peroxisome proliferator activated receptor binding; protein binding; transcription coactivator activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; patterning of blood vessels; DNA damage response, signal transduction resulting in induction of apoptosis; heart development; cellular respiration; muscle cell development; regulation of synaptic plasticity; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; inflammatory response; positive regulation of tumor necrosis factor production

Research Articles on NFATC4

Similar Products

Product Notes

The NFATC4 nfatc4 (Catalog #AAA3244097) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NFATC4 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFATC4 nfatc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSIRITSISP TPEPPAALED NPDAWGDGSP RDYPPPEGFG GYREAGGQGG. It is sometimes possible for the material contained within the vial of "NFATC4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.