Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NDUFAF5 blocking peptide

NDUFAF5 Peptide - N-terminal region

Gene Names
NDUFAF5; C20orf7; MC1DN16; dJ842G6.1; bA526K24.2
Reactivity
Human
Applications
Western Blot
Synonyms
NDUFAF5; NDUFAF5 Peptide - N-terminal region; NDUFAF5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TLNIFDRDLKRKQKNWAARQPEPTKFDYLKEEVGSRIADRVYDIPRNFPL
Sequence Length
345
Applicable Applications for NDUFAF5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NDUFAF5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NDUFAF5 Antibody, made

Target Description: The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of the mitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrial complex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for NDUFAF5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
arginine-hydroxylase NDUFAF5, mitochondrial isoform 1
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase complex assembly factor 5
NCBI Official Symbol
NDUFAF5
NCBI Official Synonym Symbols
C20orf7; MC1DN16; dJ842G6.1; bA526K24.2
NCBI Protein Information
arginine-hydroxylase NDUFAF5, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5
Protein Family
UniProt Gene Name
NDUFAF5
UniProt Synonym Gene Names
C20orf7
UniProt Entry Name
NDUF5_HUMAN

NCBI Description

The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of the mitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrial complex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

Research Articles on NDUFAF5

Similar Products

Product Notes

The NDUFAF5 ndufaf5 (Catalog #AAA3242226) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NDUFAF5 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFAF5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFAF5 ndufaf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLNIFDRDLK RKQKNWAARQ PEPTKFDYLK EEVGSRIADR VYDIPRNFPL. It is sometimes possible for the material contained within the vial of "NDUFAF5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.