Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NDUFA4 blocking peptide

NDUFA4 Peptide - middle region

Gene Names
NDUFA4; MLRQ; CI-9k; COXFA4; CI-MLRQ
Reactivity
Human
Applications
Western Blot
Synonyms
NDUFA4; NDUFA4 Peptide - middle region; NDUFA4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Sequence Length
81
Applicable Applications for NDUFA4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NDUFA4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NDUFA4 Antibody, made

Target Description: The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for NDUFA4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Full Name
cytochrome c oxidase subunit NDUFA4
NCBI Official Synonym Full Names
NDUFA4 mitochondrial complex associated
NCBI Official Symbol
NDUFA4
NCBI Official Synonym Symbols
MLRQ; CI-9k; COXFA4; CI-MLRQ
NCBI Protein Information
cytochrome c oxidase subunit NDUFA4
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4
Protein Family
UniProt Gene Name
NDUFA4
UniProt Synonym Gene Names
CI-MLRQ
UniProt Entry Name
NDUA4_HUMAN

NCBI Description

The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]

Uniprot Description

NDUFA4: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFA4 subunit family.

Protein type: Oxidoreductase; Mitochondrial; Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; EC 1.6.99.3

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial respiratory chain complex IV; mitochondrial respiratory chain complex I

Molecular Function: protein binding; cytochrome-c oxidase activity; NADH dehydrogenase (ubiquinone) activity; protein complex binding

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFA4

Similar Products

Product Notes

The NDUFA4 ndufa4 (Catalog #AAA3244275) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NDUFA4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFA4 ndufa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YLLRLALFNP DVCWDRNNPE PWNKLGPNDQ YKFYSVNVDY SKLKKERPDF. It is sometimes possible for the material contained within the vial of "NDUFA4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.