Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NCF1 blocking peptide

NCF1 Peptide - C-terminal region

Gene Names
NCF1; NCF1A; NOXO2; p47phox; SH3PXD1A
Reactivity
Human
Synonyms
NCF1; NCF1 Peptide - C-terminal region; NCF1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: RFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCS
Sequence Length
390
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NCF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NCF1 Antibody, made

Target Description: The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease.
Product Categories/Family for NCF1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
neutrophil cytosol factor 1
NCBI Official Synonym Full Names
neutrophil cytosolic factor 1
NCBI Official Symbol
NCF1
NCBI Official Synonym Symbols
NCF1A; NOXO2; p47phox; SH3PXD1A
NCBI Protein Information
neutrophil cytosol factor 1
UniProt Protein Name
Neutrophil cytosol factor 1
Protein Family
UniProt Gene Name
NCF1
UniProt Synonym Gene Names
NOXO2; SH3PXD1A; NCF-1
UniProt Entry Name
NCF1_HUMAN

NCBI Description

The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. [provided by RefSeq, Jul 2008]

Uniprot Description

p47phox: the 47-kilodalton cytosolic subunit of the multi-protein complex known as NADPH oxidase found in neutrophils. The holo-oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Contains 2 SH2 domains. Mutations in NCF1, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease.

Protein type: EC 1.-.-.-; Oxidoreductase

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: Golgi apparatus; extrinsic to membrane; rough endoplasmic reticulum; cell soma; dendrite; cytosol; NADPH oxidase complex

Molecular Function: protein binding; electron carrier activity; superoxide-generating NADPH oxidase activity; phosphatidylinositol-3,4-bisphosphate binding; SH3 domain binding; phosphoinositide binding

Biological Process: respiratory burst during defense response; respiratory burst; interaction with host; apoptosis; superoxide metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; leukotriene metabolic process; cell proliferation; antigen processing and presentation of peptide antigen via MHC class I; negative regulation of smooth muscle contraction; antigen processing and presentation of exogenous peptide antigen via MHC class I; cellular defense response; innate immune response; response to yeast; vascular endothelial growth factor receptor signaling pathway; protein targeting to membrane; inflammatory response; superoxide release; hydrogen peroxide biosynthetic process

Disease: Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-positive, Type I

Research Articles on NCF1

Similar Products

Product Notes

The NCF1 ncf1 (Catalog #AAA3247058) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NCF1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFLQQRRRQA RPGPQSPGSP LEEERQTQRS KPQPAVPPRP SADLILNRCS. It is sometimes possible for the material contained within the vial of "NCF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.