Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MYL12B blocking peptide

MYL12B Peptide - C-terminal region

Gene Names
MYL12B; MLC-B; MRLC2
Reactivity
Human
Applications
Western Blot
Synonyms
MYL12B; MYL12B Peptide - C-terminal region; MYL12B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
Sequence Length
172
Applicable Applications for MYL12B blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MYL12B blocking peptide
This is a synthetic peptide designed for use in combination with anti-MYL12B Antibody, made

Target Description: The activity of nonmuscle myosin II is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments.
Product Categories/Family for MYL12B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
myosin regulatory light chain 12B
NCBI Official Synonym Full Names
myosin light chain 12B
NCBI Official Symbol
MYL12B
NCBI Official Synonym Symbols
MLC-B; MRLC2
NCBI Protein Information
myosin regulatory light chain 12B
UniProt Protein Name
Myosin regulatory light chain 12B
Protein Family
UniProt Gene Name
MYL12B
UniProt Synonym Gene Names
MRLC2; MYLC2B; MLC-2; MLC20
UniProt Entry Name
ML12B_HUMAN

NCBI Description

The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008]

Uniprot Description

MRLC2: non-sarcomeric myosin regulatory light chain 2. Binds calcium and plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity. Phosphorylation of MLC-2 in the presence of calcium and calmodulin increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. Myosin is an hexamer of 2 heavy chains and 4 light chains.

Protein type: Contractile

Chromosomal Location of Human Ortholog: 18p11.31

Cellular Component: myosin II complex; apical part of cell; stress fiber; Z disc; cytosol

Molecular Function: protein binding; calcium ion binding

Biological Process: axon guidance; regulation of cell shape; muscle contraction; ephrin receptor signaling pathway

Research Articles on MYL12B

Similar Products

Product Notes

The MYL12B myl12b (Catalog #AAA3243000) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MYL12B Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYL12B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYL12B myl12b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKLNGTDPED VIRNAFACFD EEATGTIQED YLRELLTTMG DRFTDEEVDE. It is sometimes possible for the material contained within the vial of "MYL12B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.