Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MEAF6 blocking peptide

MEAF6 Peptide - C-terminal region

Gene Names
MEAF6; EAF6; CENP-28; C1orf149; NY-SAR-91
Reactivity
Human
Synonyms
MEAF6; MEAF6 Peptide - C-terminal region; MEAF6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASST
Sequence Length
191
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MEAF6 blocking peptide
This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants.
Product Categories/Family for MEAF6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
chromatin modification-related protein MEAF6 isoform 2
NCBI Official Synonym Full Names
MYST/Esa1 associated factor 6
NCBI Official Symbol
MEAF6
NCBI Official Synonym Symbols
EAF6; CENP-28; C1orf149; NY-SAR-91
NCBI Protein Information
chromatin modification-related protein MEAF6
UniProt Protein Name
Chromatin modification-related protein MEAF6
UniProt Gene Name
MEAF6
UniProt Synonym Gene Names
C1orf149; EAF6; MYST/Esa1-associated factor 6; Protein EAF6 homolog; hEAF6
UniProt Entry Name
EAF6_HUMAN

NCBI Description

This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

MEAF6: Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Belongs to the EAF6 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Unknown function

Chromosomal Location of Human Ortholog: 1p35.3-p33

Cellular Component: nucleoplasm; centrosome; NuA4 histone acetyltransferase complex; cytoplasm; nucleolus

Molecular Function: protein binding

Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on MEAF6

Similar Products

Product Notes

The MEAF6 meaf6 (Catalog #AAA3226485) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MEAF6 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIEKREPGSG TESDTSPDFH NQENEPSQED PEDLDGSVQG VKPQKAASST. It is sometimes possible for the material contained within the vial of "MEAF6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.