Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MC1R blocking peptide

MC1R Peptide - C-terminal region

Gene Names
MC1R; CMM5; MSH-R; SHEP2
Reactivity
Human
Synonyms
MC1R; MC1R Peptide - C-terminal region; MC1R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS
Sequence Length
317
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MC1R blocking peptide
This is a synthetic peptide designed for use in combination with anti-MC1R Antibody, made

Target Description: This intronless gene encodes the receptor protein for melanocyte-stimulating hormone (MSH). The encoded protein, a seven pass transmembrane G protein coupled receptor, controls melanogenesis. Two types of melanin exist: red pheomelanin and black eumelanin. Gene mutations that lead to a loss in function are associated with increased pheomelanin production, which leads to lighter skin and hair color. Eumelanin is photoprotective but pheomelanin may contribute to UV-induced skin damage by generating free radicals upon UV radiation. Binding of MSH to its receptor activates the receptor and stimulates eumelanin synthesis. This receptor is a major determining factor in sun sensitivity and is a genetic risk factor for melanoma and non-melanoma skin cancer. Over 30 variant alleles have been identified which correlate with skin and hair color, providing evidence that this gene is an important component in determining normal human pigment variation.
Product Categories/Family for MC1R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
melanocyte-stimulating hormone receptor
NCBI Official Synonym Full Names
melanocortin 1 receptor
NCBI Official Symbol
MC1R
NCBI Official Synonym Symbols
CMM5; MSH-R; SHEP2
NCBI Protein Information
melanocyte-stimulating hormone receptor
UniProt Protein Name
Melanocyte-stimulating hormone receptor
UniProt Gene Name
MC1R
UniProt Synonym Gene Names
MSHR; MSH-R; MC1-R
UniProt Entry Name
MSHR_HUMAN

NCBI Description

This intronless gene encodes the receptor protein for melanocyte-stimulating hormone (MSH). The encoded protein, a seven pass transmembrane G protein coupled receptor, controls melanogenesis. Two types of melanin exist: red pheomelanin and black eumelanin. Gene mutations that lead to a loss in function are associated with increased pheomelanin production, which leads to lighter skin and hair color. Eumelanin is photoprotective but pheomelanin may contribute to UV-induced skin damage by generating free radicals upon UV radiation. Binding of MSH to its receptor activates the receptor and stimulates eumelanin synthesis. This receptor is a major determining factor in sun sensitivity and is a genetic risk factor for melanoma and non-melanoma skin cancer. Over 30 variant alleles have been identified which correlate with skin and hair color, providing evidence that this gene is an important component in determining normal human pigment variation. [provided by RefSeq, Jul 2008]

Uniprot Description

MC1R: Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Genetic variations in MC1R are a cause of susceptibility to cutaneous malignant melanoma type 5 (CMM5). Malignant melanoma is a malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but also may involve other sites. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; hormone binding; melanocortin receptor activity; ubiquitin protein ligase binding; melanocyte stimulating hormone receptor activity; peptide receptor activity, G-protein coupled

Biological Process: melanin biosynthetic process; positive regulation of protein kinase B signaling cascade; G-protein signaling, coupled to cyclic nucleotide second messenger; UV protection; pigmentation; multicellular organismal development; positive regulation of cAMP biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; sensory perception of pain

Disease: Albinism, Oculocutaneous, Type Ii; Melanoma, Cutaneous Malignant, Susceptibility To, 5; Increased Analgesia From Kappa-opioid Receptor Agonist, Female-specific; Skin/hair/eye Pigmentation, Variation In, 2

Research Articles on MC1R

Similar Products

Product Notes

The MC1R mc1r (Catalog #AAA3240845) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MC1R Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: CPEHPTCGCI FKNFNLFLAL IICNAIIDPL IYAFHSQELR RTLKEVLTCS. It is sometimes possible for the material contained within the vial of "MC1R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.