Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MACROD2 blocking peptide

MACROD2 Peptide - C-terminal region

Gene Names
MACROD2; C2orf133; C20orf133
Reactivity
Human
Applications
Western Blot
Synonyms
MACROD2; MACROD2 Peptide - C-terminal region; MACROD2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GSSDLENTPGPDVEMNSQVDKVNDPTESQQEDQLIAGAQDEAKEQRNGTK
Sequence Length
213
Applicable Applications for MACROD2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MACROD2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-MACROD2 Antibody, made

Target Description: MACROD2 deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins.
Product Categories/Family for MACROD2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ADP-ribose glycohydrolase MACROD2 isoform 2
NCBI Official Synonym Full Names
mono-ADP ribosylhydrolase 2
NCBI Official Symbol
MACROD2
NCBI Official Synonym Symbols
C2orf133; C20orf133
NCBI Protein Information
ADP-ribose glycohydrolase MACROD2; O-acetyl-ADP-ribose deacetylase MACROD2
UniProt Protein Name
O-acetyl-ADP-ribose deacetylase MACROD2
UniProt Gene Name
MACROD2
UniProt Synonym Gene Names
C20orf133
UniProt Entry Name
MACD2_HUMAN

NCBI Description

The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017]

Uniprot Description

MACROD2: Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.1.-

Chromosomal Location of Human Ortholog: 20p12.1

Cellular Component: nucleus

Molecular Function: deacetylase activity; hydrolase activity, acting on glycosyl bonds

Biological Process: protein amino acid de-ADP-ribosylation; purine nucleoside metabolic process; brain development; response to DNA damage stimulus

Research Articles on MACROD2

Similar Products

Product Notes

The MACROD2 macrod2 (Catalog #AAA3242268) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MACROD2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MACROD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MACROD2 macrod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GSSDLENTPG PDVEMNSQVD KVNDPTESQQ EDQLIAGAQD EAKEQRNGTK. It is sometimes possible for the material contained within the vial of "MACROD2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.