Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LASP1 blocking peptide

LASP1 Peptide - middle region

Gene Names
LASP1; MLN50; Lasp-1
Reactivity
Human
Applications
Western Blot
Synonyms
LASP1; LASP1 Peptide - middle region; LASP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRP
Sequence Length
323
Applicable Applications for LASP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LASP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-LASP1 Antibody, made

Target Description: This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer.
Product Categories/Family for LASP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
LIM and SH3 domain protein 1 isoform b
NCBI Official Synonym Full Names
LIM and SH3 protein 1
NCBI Official Symbol
LASP1
NCBI Official Synonym Symbols
MLN50; Lasp-1
NCBI Protein Information
LIM and SH3 domain protein 1
UniProt Protein Name
LIM and SH3 domain protein 1
UniProt Gene Name
LASP1
UniProt Synonym Gene Names
MLN50; LASP-1; MLN 50
UniProt Entry Name
LASP1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012]

Uniprot Description

Lasp-1: a member of the LIM protein subfamily, characterized by a LIM motif and SH3 domain. Functions as an actin-binding protein, possibly in cytoskeletal organization.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q11-q21.3

Cellular Component: cortical actin cytoskeleton; focal adhesion

Molecular Function: actin filament binding; protein binding; SH3/SH2 adaptor activity; zinc ion binding; ion transmembrane transporter activity

Biological Process: positive regulation of signal transduction; ion transport

Research Articles on LASP1

Similar Products

Product Notes

The LASP1 lasp1 (Catalog #AAA3244633) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LASP1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LASP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LASP1 lasp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELQRIKKTQD QISNIKYHEE FEKSRMGPSG GEGMEPERRD SQDGSSYRRP. It is sometimes possible for the material contained within the vial of "LASP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.