Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KRT33A blocking peptide

KRT33A Peptide - N-terminal region

Gene Names
KRT33A; HA3I; K33A; Ha-3I; Krt1-3; hHa3-I; KRTHA3A
Reactivity
Human
Applications
Western Blot
Synonyms
KRT33A; KRT33A Peptide - N-terminal region; KRT33A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IDNAKLASDDFRTKYETELSLRQLVESDINGLRRILDELTLCRSDLEAQV
Sequence Length
404
Applicable Applications for KRT33A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KRT33A blocking peptide
This is a synthetic peptide designed for use in combination with anti-KRT33A Antibody, made

Target Description: This gene encodes a member of the keratin gene family. This gene is one of multiple type I hair keratin genes that are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. As a type I hair keratin, the encoded protein is an acidic protein which heterodimerizes with type II keratins to form hair and nails. There are two isoforms of this protein, encoded by two separate genes, keratin 33A and keratin 33B.
Product Categories/Family for KRT33A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
keratin, type I cuticular Ha3-I
NCBI Official Synonym Full Names
keratin 33A
NCBI Official Symbol
KRT33A
NCBI Official Synonym Symbols
HA3I; K33A; Ha-3I; Krt1-3; hHa3-I; KRTHA3A
NCBI Protein Information
keratin, type I cuticular Ha3-I
UniProt Protein Name
Keratin, type I cuticular Ha3-I
Protein Family
UniProt Gene Name
KRT33A
UniProt Synonym Gene Names
HHA3-I; HKA3A; KRTHA3A; K33A
UniProt Entry Name
KT33A_HUMAN

NCBI Description

This gene encodes a member of the keratin gene family. This gene is one of multiple type I hair keratin genes that are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. As a type I hair keratin, the encoded protein is an acidic protein which heterodimerizes with type II keratins to form hair and nails. There are two isoforms of this protein, encoded by two separate genes, keratin 33A and keratin 33B. [provided by RefSeq, May 2012]

Uniprot Description

KRT33A: a member of the keratin gene family. This gene is one of multiple type I hair keratin genes that are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. As a type I hair keratin, the encoded protein is an acidic protein which heterodimerizes with type II keratins to form hair and nails. There are two isoforms of this protein, encoded by two separate genes, keratin 33A and keratin 33B. [provided by RefSeq, May 2012]

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: extracellular space; intermediate filament

Molecular Function: structural molecule activity

Similar Products

Product Notes

The KRT33A krt33a (Catalog #AAA3243480) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KRT33A Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRT33A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KRT33A krt33a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDNAKLASDD FRTKYETELS LRQLVESDIN GLRRILDELT LCRSDLEAQV. It is sometimes possible for the material contained within the vial of "KRT33A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.