JOSD1 blocking peptide
JOSD1 Peptide - N-terminal region
Gene Names
JOSD1; dJ508I15.2
Reactivity
Human
Applications
Western Blot
Synonyms
JOSD1; JOSD1 Peptide - N-terminal region; JOSD1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAF
Sequence Length
202
Applicable Applications for JOSD1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for JOSD1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-JOSD1 Antibody, made
Target Description: JOSD1 has low protease activity towards poly-ubiquitin chains (in vitro) and may act as a deubiquitinating enzyme.
Target Description: JOSD1 has low protease activity towards poly-ubiquitin chains (in vitro) and may act as a deubiquitinating enzyme.
Product Categories/Family for JOSD1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
josephin-1
NCBI Official Synonym Full Names
Josephin domain containing 1
NCBI Official Symbol
JOSD1
NCBI Official Synonym Symbols
dJ508I15.2
NCBI Protein Information
josephin-1
UniProt Protein Name
Josephin-1
Protein Family
UniProt Gene Name
JOSD1
UniProt Synonym Gene Names
JSPH1; KIAA0063
UniProt Entry Name
JOS1_HUMAN
Uniprot Description
JOSD1: Has low protease activity towards poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme.
Protein type: EC 3.4.19.12
Chromosomal Location of Human Ortholog: 22q13.1
Cellular Component: membrane; cytoplasm; plasma membrane
Molecular Function: omega peptidase activity
Biological Process: proteolysis
Research Articles on JOSD1
Similar Products
Product Notes
The JOSD1 josd1 (Catalog #AAA3243441) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The JOSD1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's JOSD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the JOSD1 josd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCVPWKGDKA KSESLELPQA APPQIYHEKQ RRELCALHAL NNVFQDSNAF. It is sometimes possible for the material contained within the vial of "JOSD1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
