Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ITGA2 blocking peptide

ITGA2 Peptide - C-terminal region

Gene Names
ITGA2; BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Synonyms
ITGA2; ITGA2 Peptide - C-terminal region; ITGA2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
Sequence Length
1181
Applicable Applications for ITGA2 blocking peptide
Immunofluorescence (IF), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ITGA2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ITGA2 Antibody, made

Target Description: This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.
Product Categories/Family for ITGA2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
integrin alpha-2
NCBI Official Synonym Full Names
integrin subunit alpha 2
NCBI Official Symbol
ITGA2
NCBI Official Synonym Symbols
BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2
NCBI Protein Information
integrin alpha-2
UniProt Protein Name
Integrin alpha-2
Protein Family
UniProt Gene Name
ITGA2
UniProt Synonym Gene Names
CD49B; GPIa
UniProt Entry Name
ITA2_HUMAN

NCBI Description

This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

ITGA2: Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Belongs to the integrin alpha chain family.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: cell surface; focal adhesion; perinuclear region of cytoplasm; plasma membrane; nerve terminal; integrin complex; nucleus; external side of plasma membrane

Molecular Function: integrin binding; collagen binding; viral receptor activity; protein binding; protein heterodimerization activity; metal ion binding; laminin binding

Biological Process: axon guidance; entry of virus into host cell; extracellular matrix organization and biogenesis; response to muscle activity; positive regulation of positive chemotaxis; positive regulation of cell adhesion; positive regulation of translation; positive regulation of leukocyte migration; cell-matrix adhesion; positive regulation of smooth muscle cell proliferation; positive regulation of collagen binding; positive regulation of collagen biosynthetic process; positive regulation of cell projection organization and biogenesis; mesodermal cell differentiation; positive regulation of smooth muscle cell migration; response to L-ascorbic acid; response to organic cyclic substance; establishment of protein localization; mammary gland development; positive regulation of smooth muscle contraction; cell adhesion; positive regulation of DNA binding; substrate-bound cell migration; integrin-mediated signaling pathway; response to drug; skin morphogenesis; hypotonic response; cell-substrate adhesion; cellular response to hormone stimulus; cell proliferation; detection of mechanical stimulus involved in sensory perception of pain; organ morphogenesis; response to hypoxia; cell adhesion mediated by integrin; positive regulation of phagocytosis, engulfment; blood coagulation; positive regulation of transmission of nerve impulse; positive regulation of inflammatory response; response to amine stimulus

Disease: Bleeding Disorder, Platelet-type, 9

Research Articles on ITGA2

Similar Products

Product Notes

The ITGA2 itga2 (Catalog #AAA3241264) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ITGA2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the ITGA2 itga2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LQNLQNQASL SFQALSESQE ENKADNLVNL KIPLLYDAEI HLTRSTNINF. It is sometimes possible for the material contained within the vial of "ITGA2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.