Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GUCA1B blocking peptide

GUCA1B Peptide - N-terminal region

Gene Names
GUCA1B; RP48; GCAP2; GUCA2; GCAP 2
Reactivity
Human
Applications
Western Blot
Synonyms
GUCA1B; GUCA1B Peptide - N-terminal region; GUCA1B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN
Sequence Length
200
Applicable Applications for GUCA1B blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GUCA1B blocking peptide
This is a synthetic peptide designed for use in combination with anti-GUCA1B Antibody, made

Target Description: The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa.
Product Categories/Family for GUCA1B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
guanylyl cyclase-activating protein 2
NCBI Official Synonym Full Names
guanylate cyclase activator 1B
NCBI Official Symbol
GUCA1B
NCBI Official Synonym Symbols
RP48; GCAP2; GUCA2; GCAP 2
NCBI Protein Information
guanylyl cyclase-activating protein 2
UniProt Protein Name
Guanylyl cyclase-activating protein 2
UniProt Gene Name
GUCA1B
UniProt Synonym Gene Names
GCAP2; GCAP 2
UniProt Entry Name
GUC1B_HUMAN

NCBI Description

The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009]

Uniprot Description

GCAP2: Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low, and GC1 and GC2 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure. Defects in GUCA1B are the cause of retinitis pigmentosa type 48 (RP48). RP48 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: photoreceptor inner segment

Molecular Function: calcium sensitive guanylate cyclase activator activity; calcium ion binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; cell-cell signaling; receptor guanylyl cyclase signaling pathway; positive regulation of guanylate cyclase activity; body fluid secretion

Disease: Retinitis Pigmentosa 48

Research Articles on GUCA1B

Similar Products

Product Notes

The GUCA1B guca1b (Catalog #AAA3239433) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GUCA1B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GUCA1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GUCA1B guca1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SGTLFMHEFK RFFKVTDDEE ASQYVEGMFR AFDKNGDNTI DFLEYVAALN. It is sometimes possible for the material contained within the vial of "GUCA1B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.