Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GSG1L blocking peptide

GSG1L Peptide - N-terminal region

Gene Names
GSG1L; PRO19651
Reactivity
Human
Applications
Western Blot
Synonyms
GSG1L; GSG1L Peptide - N-terminal region; GSG1L blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NFHTGIWYSCEEELSGLGEKCRSFIDLAPASEKGVLWLSVVSEVLYILLL
Sequence Length
280
Applicable Applications for GSG1L blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GSG1L blocking peptide
This is a synthetic peptide designed for use in combination with anti-GSG1L Antibody, made

Target Description: As a component of the inner core of AMPAR complex, GSG1L modifies AMPA receptor (AMPAR) gating.
Product Categories/Family for GSG1L blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
germ cell-specific gene 1-like protein isoform 2
NCBI Official Synonym Full Names
GSG1 like
NCBI Official Symbol
GSG1L
NCBI Official Synonym Symbols
PRO19651
NCBI Protein Information
germ cell-specific gene 1-like protein
UniProt Protein Name
Germ cell-specific gene 1-like protein
UniProt Gene Name
GSG1L
UniProt Synonym Gene Names
GSG1-like protein
UniProt Entry Name
GSG1L_HUMAN

Uniprot Description

Function: As a component of the inner core of AMPAR complex, modifies AMPA receptor (AMPAR) gating

By similarity.

Subunit structure: Component of the inner core of AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity. Cell junction › synapse

By similarity.

Sequence similarities: Belongs to the GSG1 family.

Research Articles on GSG1L

Similar Products

Product Notes

The GSG1L gsg1l (Catalog #AAA3236683) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GSG1L Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSG1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSG1L gsg1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NFHTGIWYSC EEELSGLGEK CRSFIDLAPA SEKGVLWLSV VSEVLYILLL. It is sometimes possible for the material contained within the vial of "GSG1L, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.