Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GMNN blocking peptide

GMNN Peptide - middle region

Gene Names
GMNN; Gem; MGORS6
Reactivity
Human
Synonyms
GMNN; GMNN Peptide - middle region; GMNN blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKE
Sequence Length
209
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GMNN blocking peptide
This is a synthetic peptide designed for use in combination with anti- GMNN Antibody, made

Target Description: This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16.
Product Categories/Family for GMNN blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
geminin
NCBI Official Synonym Full Names
geminin DNA replication inhibitor
NCBI Official Symbol
GMNN
NCBI Official Synonym Symbols
Gem; MGORS6
NCBI Protein Information
geminin
UniProt Protein Name
Geminin
Protein Family
UniProt Gene Name
GMNN
UniProt Entry Name
GEMI_HUMAN

NCBI Description

This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16. [provided by RefSeq, Oct 2011]

Uniprot Description

Geminin: Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle. Homotetramer. Interacts with CDT1; inhibits binding of the MCM complex to origins of replication. Interacts with IDAS; targets GMNN to the nucleus, prevents GMNN interaction with CDT1 and competes with IDAS homodimerization. Belongs to the geminin family.

Protein type: Cell cycle regulation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; histone deacetylase binding; transcription corepressor activity

Biological Process: organ morphogenesis; negative regulation of DNA replication; protein complex assembly; mitotic cell cycle; negative regulation of transcription, DNA-dependent; negative regulation of cell cycle

Research Articles on GMNN

Similar Products

Product Notes

The GMNN gmnn (Catalog #AAA3247869) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GMNN Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMIKENPSSQ YWKEVAEKRR KALYEALKEN EKLHKEIEQK DNEIARLKKE. It is sometimes possible for the material contained within the vial of "GMNN, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.