GGA2 blocking peptide

GGA2 Peptide - N-terminal region

Cat. Num. AAA3241188

• Gene Names: GGA2; VEAR
• Reactivity: Human
• Applications: Western Blot
• Synonyms: GGA2; GGA2 Peptide - N-terminal region; GGA2 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH
• Sequence Length: 613

• Applicable Applications for GGA2 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for GGA2 blocking peptide

This is a synthetic peptide designed for use in combination with anti-GGA2 Antibody, made

Target Description: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. This family member may play a significant role in cargo molecules regulation and clathrin-coated vesicle assembly.

Product Categories/Family for GGA2 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 9558751
• NCBI GeneID: 23062
• NCBI Accession #: NP_055859
• NCBI GenBank Nucleotide #: NM_015044
• UniProt Accession #: Q9UJY4
• Molecular Weight: 67kDa
• NCBI Official Full Name: ADP-ribosylation factor-binding protein GGA2
• NCBI Official Synonym Full Names: golgi associated, gamma adaptin ear containing, ARF binding protein 2
• NCBI Official Symbol: GGA2
• NCBI Official Synonym Symbols: VEAR
• NCBI Protein Information: ADP-ribosylation factor-binding protein GGA2
• UniProt Protein Name: ADP-ribosylation factor-binding protein GGA2
• Protein Family: ADP-ribosylation factor-binding protein
• UniProt Gene Name: GGA2
• UniProt Synonym Gene Names: KIAA1080; Vear
• UniProt Entry Name: GGA2_HUMAN

NCBI Description

This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. This family member may play a significant role in cargo molecules regulation and clathrin-coated vesicle assembly. [provided by RefSeq, Jul 2008]

Uniprot Description

GGA2: Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF- dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif. Belongs to the GGA protein family.

Protein type: Adaptor/scaffold; Vesicle

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: Golgi apparatus; clathrin adaptor complex; clathrin-coated vesicle; endosome membrane; trans-Golgi network

Molecular Function: ADP-ribosylation factor binding; protein binding

Biological Process: vesicle-mediated transport; intracellular protein transport