Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GCFC2 blocking peptide

GCFC2 Peptide - N-terminal region

Gene Names
GCFC2; GCF; TCF9; DNABF; C2orf3
Reactivity
Human
Applications
Western Blot
Synonyms
GCFC2; GCFC2 Peptide - N-terminal region; GCFC2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQE
Sequence Length
781
Applicable Applications for GCFC2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GCFC2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-GCFC2 Antibody, made

Target Description: The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.
Product Categories/Family for GCFC2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
GC-rich sequence DNA-binding factor 2 isoform 1
NCBI Official Synonym Full Names
GC-rich sequence DNA-binding factor 2
NCBI Official Symbol
GCFC2
NCBI Official Synonym Symbols
GCF; TCF9; DNABF; C2orf3
NCBI Protein Information
GC-rich sequence DNA-binding factor 2
UniProt Protein Name
GC-rich sequence DNA-binding factor 2
UniProt Gene Name
GCFC2
UniProt Synonym Gene Names
C2orf3; GCF; TCF9; TCF-9
UniProt Entry Name
GCFC2_HUMAN

NCBI Description

The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TCF9: Factor that represses transcription. It binds to the GC- rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters. Belongs to the GCF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: nucleoplasm; nucleolus; nucleus

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; spliceosome assembly; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on GCFC2

Similar Products

Product Notes

The GCFC2 gcfc2 (Catalog #AAA3238671) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GCFC2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCFC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GCFC2 gcfc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKRESEDDPE SEPDDHEKRI PFTLRPQTLR QRMAEESISR NEETSEESQE. It is sometimes possible for the material contained within the vial of "GCFC2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.