Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FSBP blocking peptide

FSBP Peptide - middle region

Gene Names
RAD54B; RDH54
Reactivity
Human
Synonyms
FSBP; FSBP Peptide - middle region; FSBP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAK
Sequence Length
299
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FSBP blocking peptide
This is a synthetic peptide designed for use in combination with anti- FSBP Antibody, made

Target Description: Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1.
Product Categories/Family for FSBP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
DNA repair and recombination protein RAD54B isoform 2
NCBI Official Synonym Full Names
RAD54 homolog B
NCBI Official Symbol
RAD54B
NCBI Official Synonym Symbols
RDH54
NCBI Protein Information
DNA repair and recombination protein RAD54B
UniProt Protein Name
Fibrinogen silencer-binding protein
UniProt Gene Name
FSBP
UniProt Entry Name
FSBP_HUMAN

NCBI Description

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

FSBP: Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1. Interacts with APBA1 (via PDZ 1 and 2 domains). 2 isoforms of the human protein are produced by alternative splicing

Chromosomal Location of Human Ortholog: 8q22.1

Cellular Component: nucleus

Molecular Function: DNA helicase activity; DNA binding; DNA translocase activity; RNA helicase activity; ATP binding

Biological Process: mitotic recombination; meiotic recombination; DNA duplex unwinding; double-strand break repair via homologous recombination

Research Articles on FSBP

Similar Products

Product Notes

The FSBP fsbp (Catalog #AAA3247949) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FSBP Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGYDPQILQM LKEEHQIILE NQKNFGLYVQ EKRDGLKRRQ QLEEELLRAK. It is sometimes possible for the material contained within the vial of "FSBP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.